CoraLite® Plus 647 Anti-Human 4-1BBL/TNFSF9 Rabbit Recombinant Antibody

4-1BBL/TNFSF9 Uni-rAb® Recombinant Antibody for FC
Cat No. CL647-98163
Clone No.241386G2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

TNFSF9, 241386G2, 4 1BB L, 4 1BB ligand, 4 1BBL

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inRaji cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in 100 μl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-98163 targets 4-1BBL/TNFSF9 in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0010

Product name: Recombinant Human TNFSF9 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec

Tag: N-6*his

Domain: 71-254 aa of BC104805

Sequence: REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Predict reactive species
Full Name tumor necrosis factor (ligand) superfamily, member 9
Calculated Molecular Weight 254 aa, 27 kDa
GenBank Accession NumberBC104805
Gene Symbol TNFSF9
Gene ID (NCBI) 8744
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP41273
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

TNFSF9, also named as 4-1BBL, belongs to the tumor necrosis factor family. It is a cytokine that binds to TNFRSF9. TNSF9 induces the proliferation of activated peripheral blood T-cells. It may have a role in activation-induced cell death (AICD) and may play a role in cognate interactions between T-cells and B-cells/macrophages.

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 4-1BBL/TNFSF9 antibody CL647-98163Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...