• Featured Product
  • KD/KO Validated

4EBP1 Recombinant monoclonal antibody

4EBP1 Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 83890-5-RR
Clone No.241055E7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

EIF4EBP1, 241055E7, 4E BP1, 4E-BP1, BP 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, K-562 cells, HL-60 cells, HepG2 cells, HeLa cells, A431 cells
Positive FC (Intra) detected inHEK-293 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83890-5-RR targets 4EBP1 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5056

Product name: Recombinant human 4EBP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-118 aa of BC004459

Sequence: MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

Predict reactive species
Full Name eukaryotic translation initiation factor 4E binding protein 1
Calculated Molecular Weight 118 aa, 12 kDa
Observed Molecular Weight15-20 kDa
GenBank Accession NumberBC004459
Gene Symbol EIF4EBP1
Gene ID (NCBI) 1978
RRIDAB_3671473
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ13541
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

4EBP1 (4E-BP1) is a translational regulator and functions by sequestering eukaryotic translation initiation factor 4E (eIF4E) from the translation initiation machinery. 4E-BP1 contains at least six phosphorylation sites (Thr37, Thr46, Ser65, Thr70, Ser83, and Ser112), four of which (Thr37, Thr46, Ser65, and Thr70) are known to be regulated by mTOR signaling. Phosphorylation of Thr37 and Thr46 is thought to prime 4E-BP1 for sequential phosphorylation of Ser65 and Thr70, which results in the dissociation of 4E-BP1 from eIF4E. (PMID: 12747827)

Protocols

Product Specific Protocols
IF protocol for 4EBP1 antibody 83890-5-RRDownload protocol
WB protocol for 4EBP1 antibody 83890-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...