Use Able AI chat for product recommendations

53BP2 Polyclonal antibody

53BP2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

TP53BP2, Apoptosis-stimulating of p53 protein 2, ASPP2, BBP, Bcl2-binding protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for 53BP2 in ?

Tested Applications

Positive WB detected inHEK-293T cells, MCF-7 cells, Jurkat cells, HeLa cells
Positive IHC detected inhuman placenta tissue, human lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:20000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26550-1-AP targets 53BP2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag24907

Product name: Recombinant human TP53BP2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 273-519 aa of BC040247

Sequence: SSTMPRMPSRPELLVKPALPDGSLVIQASEGPMKIQTLPNMRSGAASQTKGSKIHPVGPDWSPSNADLFPSQGSASVPQSTGNALDQVDDGEVPLREKEKKVRPFSMFDAVDQSNAPPSFGTLRKNQSSEDILRDAQVANKNVAKVPPPVPTKPKQINLPYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFR

Predict reactive species
Full Name tumor protein p53 binding protein, 2
Observed Molecular Weight 150 kDa
GenBank Accession NumberBC040247
Gene Symbol TP53BP2
Gene ID (NCBI) 7159
RRIDAB_2880549
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13625
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TP53BP2 is also named as ASPP2, BBP and 53BP2. TP53BP2 is a regulator that plays a central role in regulation of apoptosis and cell growth via its interactions with proteins such as TP53 (PMID: 12524540). Numerous in vitro and animal experiments have shown that reduced TP53BP2 expression can inhibit apoptosis of tumor cells, cause malignant proliferation, disrupt cell polarity, promote cell migration, and enhance autophagy and drug resistance to chemotherapy (PMID: 37492707). In terms of autophagy, the decrease of TP53BP2 expression enhances autophagy in hepatocellular carcinoma (HCC) cells, promoting the survival and drug resistance of HCC cells. TP53BP2 can interact with p53, NF-κB p65, Bcl-2, HCV core protein, PP1, YAP, CagA, RAS, PAR3, and other proteins to regulate cell function. TP53BP2 can also regulate the proliferation, apoptosis, autophagy, migration, EMT and drug resistance of tumor cells through downstream signaling pathways, such as NF-κB, RAS/MAPK, mevalonate, TGF-β1, PI3K/AKT, aPKC-ι/GLI1 and autophagy pathways (PMID: 37492707).

Protocols

Product Specific Protocols
IF protocol for 53BP2 antibody 26550-1-APDownload protocol
IHC protocol for 53BP2 antibody 26550-1-APDownload protocol
WB protocol for 53BP2 antibody 26550-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The 53BP2 Polyclonal antibody (Cat# 26550-1-AP) has 1 total citation. The cited publication appeared in Advanced Science (Adv Sci Weinh), a high-impact journal (IF 14.1). The study focused on identifying PKN2 and MOB4 as coordinators of collective cell migration in human samples, using Western blot as the application. This places the research field within cell migration and cancer biology.

SpeciesApplicationTitle
humanWB

Adv Sci (Weinh)

Identification of PKN2 and MOB4 as Coordinators of Collective Cell Migration.

Authors - Artem I Fokin
  • KO Validated
Loading...
||
New chat

Able™

正在加载,请稍候...