53BP2 Polyclonal antibody

• 

  WB analysis using 26550-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26550-1-AP (53BP2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 26550-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 26550-1-AP (53BP2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human placenta using 26550-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 26550-1-AP (53BP2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 26550-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 26550-1-AP (53BP2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

53BP2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26550-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

TP53BP2, Apoptosis-stimulating of p53 protein 2, ASPP2, BBP, Bcl2-binding protein

---

Tested Applications

• Positive WB detected in: HEK-293T cells, MCF-7 cells, Jurkat cells, HeLa cells
• Positive IHC detected in: human placenta tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:20000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26550-1-AP targets 53BP2 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24907

  Product name: Recombinant human TP53BP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 273-519 aa of BC040247

  Sequence: SSTMPRMPSRPELLVKPALPDGSLVIQASEGPMKIQTLPNMRSGAASQTKGSKIHPVGPDWSPSNADLFPSQGSASVPQSTGNALDQVDDGEVPLREKEKKVRPFSMFDAVDQSNAPPSFGTLRKNQSSEDILRDAQVANKNVAKVPPPVPTKPKQINLPYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFR

• Full Name: tumor protein p53 binding protein, 2
• Observed Molecular Weight: 150 kDa
• GenBank Accession Number: BC040247
• Gene Symbol: TP53BP2
• Gene ID (NCBI): 7159
• RRID: AB_2880549
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13625
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TP53BP2 is also named as ASPP2, BBP and 53BP2. TP53BP2 is a regulator that plays a central role in regulation of apoptosis and cell growth via its interactions with proteins such as TP53 (PMID: 12524540). Numerous in vitro and animal experiments have shown that reduced TP53BP2 expression can inhibit apoptosis of tumor cells, cause malignant proliferation, disrupt cell polarity, promote cell migration, and enhance autophagy and drug resistance to chemotherapy (PMID: 37492707). In terms of autophagy, the decrease of TP53BP2 expression enhances autophagy in hepatocellular carcinoma (HCC) cells, promoting the survival and drug resistance of HCC cells. TP53BP2 can interact with p53, NF-κB p65, Bcl-2, HCV core protein, PP1, YAP, CagA, RAS, PAR3, and other proteins to regulate cell function. TP53BP2 can also regulate the proliferation, apoptosis, autophagy, migration, EMT and drug resistance of tumor cells through downstream signaling pathways, such as NF-κB, RAS/MAPK, mevalonate, TGF-β1, PI3K/AKT, aPKC-ι/GLI1 and autophagy pathways (PMID: 37492707).