Home
Products
Primary Antibodies
A4GNT Polyclonal antibody, PBS Only (22670-1-PBS)

Filter: AllWBIHC

WB analysis using 22670-1-AP (same clone as 22670-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 22670-1-AP (A4GNT antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22670-1-PBS in a different storage buffer formulation.
WB analysis of mouse pancreas using 22670-1-AP (same clone as 22670-1-PBS)
mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 22670-1-AP (A4GNT antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22670-1-PBS in a different storage buffer formulation.
WB analysis of mouse stomach using 22670-1-AP (same clone as 22670-1-PBS)
mouse stomach tissue were subjected to SDS PAGE followed by western blot with 22670-1-AP (A4GNT antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22670-1-PBS in a different storage buffer formulation.
WB analysis of rat stomach using 22670-1-AP (same clone as 22670-1-PBS)
rat stomach tissue were subjected to SDS PAGE followed by western blot with 22670-1-AP (A4GNT antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22670-1-PBS in a different storage buffer formulation.
IHC staining of human stomach cancer using 22670-1-AP (same clone as 22670-1-PBS)
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 22670-1-AP (A4GNT antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22670-1-PBS in a different storage buffer formulation.
IHC staining of human stomach cancer using 22670-1-AP (same clone as 22670-1-PBS)
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 22670-1-AP (A4GNT antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22670-1-PBS in a different storage buffer formulation.
IHC staining of human stomach using 22670-1-AP (same clone as 22670-1-PBS)
Immunohistochemical analysis of paraffin-embedded human normal stomach slide using 22670-1-AP (A4GNT antibody) at dilution of 1:300 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22670-1-PBS in a different storage buffer formulation.
IHC staining of human pancreas cancer using 22670-1-AP (same clone as 22670-1-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 22670-1-AP (A4GNT antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22670-1-PBS in a different storage buffer formulation.
IHC staining of human pancreas cancer using 22670-1-AP (same clone as 22670-1-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 22670-1-AP (A4GNT antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22670-1-PBS in a different storage buffer formulation.
IHC staining of rat stomach using 22670-1-AP (same clone as 22670-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 22670-1-AP (A4GNT antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 22670-1-PBS in a different storage buffer formulation.
IHC staining of rat stomach using 22670-1-AP (same clone as 22670-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 22670-1-AP (A4GNT antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 22670-1-PBS in a different storage buffer formulation.
IHC staining of mouse stomach using 22670-1-AP (same clone as 22670-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 22670-1-AP (A4GNT antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 22670-1-PBS in a different storage buffer formulation.
IHC staining of mouse stomach using 22670-1-AP (same clone as 22670-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 22670-1-AP (A4GNT antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 22670-1-PBS in a different storage buffer formulation.

A4GNT Polyclonal antibody, PBS Only

Name: A4GNT Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 22670-1-PBS

A4GNT Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 22670-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

EC:2.4.1.-, Alpha4GnT, Alpha-1,4-N-acetylglucosaminyltransferase

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

22670-1-PBS targets A4GNT in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag18432 Product name: Recombinant human A4GNT protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 76-340 aa of BC119639 Sequence: KIYPEWPVVFFMKGLTDSTPMPSNSTYPAFSFLSAIDNVFLFPLDMKRLLEDTPLFSWYNQINASAERNWLHISSDASRLAIIWKYGGIYMDTDVISIRPIPEENFLAAQASRYSSNGIFGFLPHHPFLWECMENFVEHYNSDIWGNQGPELMTRMLRVWCKLEDFQEVSDLRCLNISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAVIRGSNTLVENLYRKHCPRTYRDLIKGPEGSVTGELGPGNK Predict reactive species
Full Name	alpha-1,4-N-acetylglucosaminyltransferase
Calculated Molecular Weight	340 aa, 39 kDa
Observed Molecular Weight	34-37 kDa
GenBank Accession Number	BC119639
Gene Symbol	A4GNT
Gene ID (NCBI)	51146
RRID	AB_11183768
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9UNA3
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

A4GNT (alpha-1,4-N-acetylglucosaminyltransferase) catalyzes the transfer of N-acetylglucosamine (GlcNAc) to core 2 branched O-glycans, forming a unique glycan structure, GlcNAcalpha1-->4Galbeta-->R. The gene is expressed with a bias in certain tissues, particularly in the stomach (RPKM 9.5) and duodenum (RPKM 0.9). Alpha4GnT has been implicated in O-glycan biosynthesis and is thought to have a role in preventing gastric cancer by inhibiting Helicobacter pylori infection and suppressing tumor-promoting inflammation.