AASS Polyclonal antibody

• Home
• Products
• Primary Antibodies
• AASS Polyclonal antibody (29354-1-AP)

• 

  WB analysis using 29354-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29354-1-AP (AASS antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse liver using 29354-1-AP

  IP result of anti-AASS (IP:29354-1-AP, 4ug; Detection:29354-1-AP 1:3000) with mouse liver tissue lysate 2480 ug.

• 

  IHC staining of human liver cancer using 29354-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 29354-1-AP (AASS antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 29354-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 29354-1-AP (AASS antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 29354-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 29354-1-AP (AASS antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 29354-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 29354-1-AP (AASS antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

AASS Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 29354-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

LKR, LKR/SDH, LKRSDH, LOR, LORSDH

---

Tested Applications

• Positive WB detected in: mouse liver tissue, rat liver tissue
• Positive IP detected in: mouse liver tissue
• Positive IHC detected in: human liver cancer tissue, mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29354-1-AP targets AASS in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29520

  Product name: Recombinant human AASS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 33-146 aa of NM_005763

  Sequence: VNAWERRAPLAPKHIKGITNLGYKVLIQPSNRRAIHDKDYVKAGGILQEDISEACLILGVKRPPEEKLMSRKTYAFFSHTIKAQEANMGLLDEILKQEIRLIDYEKMVDHRGVR

• Full Name: aminoadipate-semialdehyde synthase
• Calculated Molecular Weight: 102 kDa
• Observed Molecular Weight: 100-110 kDa
• GenBank Accession Number: NM_005763
• Gene Symbol: AASS
• Gene ID (NCBI): 10157
• RRID: AB_3742311
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UDR5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Aminoadipate-semialdehyde synthase (AASS) is a bifunctional enzyme catalyzing the first two steps of lysine degradation via the saccharopine pathway. It possesses both lysine-ketoglutarate reductase and saccharopine dehydrogenase activities. Mutations in the AASS gene cause familial hyperlysinemia, a rare autosomal recessive disorder characterized by elevated plasma lysine levels, though clinical manifestations are typically benign. AASS dysfunction disrupts mitochondrial energy metabolism and amino acid homeostasis. Beyond its metabolic role, emerging evidence suggests AASS may influence cellular redox status and autophagy regulation, positioning it as a potential therapeutic target for metabolic disorders and lysine-related pathologies (PMID: 41158987; 10775527).