AATF Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• AATF Polyclonal antibody, PBS Only (10282-1-PBS)

• 

  WB analysis using 10282-1-AP (same clone as 10282-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10282-1-AP (AATF antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10282-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 10282-1-AP (same clone as 10282-1-PBS)

  WB result of AATF antibody (10282-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-AATF transfected HepG2 cells. This data was developed using the same antibody clone with 10282-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 10282-1-AP (same clone as 10282-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10282-1-AP (AATF Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10282-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 10282-1-AP (same clone as 10282-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 10282-1-AP (AATF antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10282-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 10282-1-AP (same clone as 10282-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using AATF antibody (10282-1-AP) at dilution of 1:1500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 10282-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

AATF Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 10282-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Apoptosis-antagonizing transcription factor, CHE 1, CHE1, DED, HSPC277

---

Product Information

10282-1-PBS targets AATF in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0195

  Product name: Recombinant human AATF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 7-212 aa of BC000591

  Sequence: LALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDFLVVGSIRKLASASLLDTDKRYCGKTTSRKAWNEDHWEQTLPGSSDEEISDEEGSGDEDSEGLGLEEYDEDDLGAAEEQECGDHRESKKSRSHSAKTPGFSVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTF

• Full Name: apoptosis antagonizing transcription factor
• Calculated Molecular Weight: 63 kDa
• Observed Molecular Weight: 80-95 kDa
• GenBank Accession Number: BC000591
• Gene Symbol: AATF
• Gene ID (NCBI): 26574
• RRID: AB_2219887
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NY61
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Apoptosis antagonizing transcription factor (AATF) is a nuclear phosphoprotein of 523 amino acids and contains an extremely acidic domain and a putative leucine zipper characteristic of transcription factors. AATF was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. Overexpression of this gene interfered with MAP3K12 induced apoptosis. AATF also binds Rb and the core of pol II, and may be part of transcription regulatory complex.