ABCA3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ABCA3 Polyclonal antibody, PBS Only (27450-1-PBS)

• 

  WB analysis using 27450-1-AP (same clone as 27450-1-PBS)

  unboiled rat lung tissue were subjected to SDS PAGE followed by western blot with 27450-1-AP (ABCA3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27450-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 27450-1-AP (same clone as 27450-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 27450-1-AP (ABCA3 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27450-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 27450-1-AP (same clone as 27450-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27450-1-AP (ABCA3 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27450-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 27450-1-AP (same clone as 27450-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27450-1-AP (ABCA3 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27450-1-PBS in a different storage buffer formulation.

ABCA3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27450-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

150 Kda mature form, ABC C transporter, ABC3, ABCA 3, ABC-C transporter

---

Product Information

27450-1-PBS targets ABCA3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24749

  Product name: Recombinant human ABCA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1606-1704 aa of BC140895

  Sequence: GSGYSLRAKVQSEGQQEALEEFKAFVDLTFPGSVLEDEHQGMVHYHLPGRDLSWAKVFGILEKAKEKYGVDDYSVSQISLEQVFLSFAHLQPPTAEEGR

• Full Name: ATP-binding cassette, sub-family A (ABC1), member 3
• Observed Molecular Weight: 140-160 kDa
• GenBank Accession Number: BC140895
• Gene Symbol: ABCA3
• Gene ID (NCBI): 21
• RRID: AB_3669603
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99758
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ABCA3 belongs to the ATP-binding cassette (ABC) transporter superfamily. ABCA3, which is expressed in alveolar type II pneumocytes and localizes predominantly to the limiting membrane of lamellar bodies, is critical for synthesis of surfactant(PMID: 17267394). Mutation of the ABCA3 gene causes fatal surfactant deficiency in newborns(PMID: 15044640).