Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, MCF-7 cells, L02 cells, MDA-MB-231 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27726-1-AP targets ABCB4 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26840 Product name: Recombinant human ABCB4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 628-706 aa of BC042531 Sequence: VNMQTSGSQIQSEEFELNDEKAATRMAPNGWKSRLFRHSTQKNLKNSQMCQKSLDVETDGLEANVPPVSFLKVLKLNKT Predict reactive species |
| Full Name | ATP-binding cassette, sub-family B (MDR/TAP), member 4 |
| Calculated Molecular Weight | 1286 aa, 142 kDa |
| Observed Molecular Weight | 130-140 kDa |
| GenBank Accession Number | BC042531 |
| Gene Symbol | ABCB4 |
| Gene ID (NCBI) | 5244 |
| RRID | AB_2918128 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P21439 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ABCB4, also known as MDR3, is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABCB4 is expressed on the apical membrane of hepatocytes and functions to transport phosphatidylcholine (PC) from hepatocytes into the bile canaliculus (PMID: 16622704).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ABCB4 antibody 27726-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



