ABCB4 Polyclonal antibody

• 

  WB analysis using 27726-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27726-1-AP (ABCB4 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27726-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27726-1-AP (ABCB4 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

ABCB4 Polyclonal Antibody for WB, ELISA

Cat No. 27726-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

ATP binding cassette sub family B member 4, ATP-binding cassette sub-family B member 4, EC:7.6.2.1, MDR3, P-glycoprotein 3

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, MCF-7 cells, L02 cells, MDA-MB-231 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

27726-1-AP targets ABCB4 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26840

  Product name: Recombinant human ABCB4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 628-706 aa of BC042531

  Sequence: VNMQTSGSQIQSEEFELNDEKAATRMAPNGWKSRLFRHSTQKNLKNSQMCQKSLDVETDGLEANVPPVSFLKVLKLNKT

• Full Name: ATP-binding cassette, sub-family B (MDR/TAP), member 4
• Calculated Molecular Weight: 1286 aa, 142 kDa
• Observed Molecular Weight: 130-140 kDa
• GenBank Accession Number: BC042531
• Gene Symbol: ABCB4
• Gene ID (NCBI): 5244
• RRID: AB_2918128
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P21439
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ABCB4, also known as MDR3, is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABCB4 is expressed on the apical membrane of hepatocytes and functions to transport phosphatidylcholine (PC) from hepatocytes into the bile canaliculus (PMID: 16622704).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Death Dis; Complex IIa formation and ABC transporters determine sensitivity of OSCC to Smac mimetics; Authors - Yuhan Wang ; KD Validated