ABCB7 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ABCB7 Polyclonal antibody (11158-1-AP)

• Featured Product
• KD/KO Validated

ABCB7 Polyclonal Antibody for WB, IP, ELISA

Cat No. 11158-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

ABC transporter 7 protein, ABC7, ABCB 7, ATP-binding cassette sub-family B member 7, mitochondrial, ATP-binding cassette transporter 7

• 

  WB analysis of mouse liver using 11158-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 11158-1-AP (ABCB7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse thymus using 11158-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 11158-1-AP (ABCB7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse liver using 11158-1-AP

  IP result of anti-ABCB7 (IP:11158-1-AP, 4ug; Detection:11158-1-AP 1:500) with mouse liver tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse thymus using 11158-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse thymus tissue slide using 11158-1-AP (ABCB7 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse liver tissue, mouse thymus tissue
• Positive IP detected in: mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11158-1-AP targets ABCB7 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1544

  Product name: Recombinant human ABCB7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-173 aa of BC006323

  Sequence: AILIRPLVSVSGSGPQWRPHQLGALGTARAYQQIPESLKSITWQRLGKGNSGQFLDAAKALQVWPLIEKRTCWHGHAGGGLHTDPKEGLKDVDTRKIIKAMLSYVWPKDRPDLRARVAISLGFLGGAKAMNIVVPFMFKYAVDSLNQMS

• Full Name: ATP-binding cassette, sub-family B (MDR/TAP), member 7
• Calculated Molecular Weight: 753 aa, 83 kDa
• Observed Molecular Weight: 83 kDa
• GenBank Accession Number: BC006323
• Gene Symbol: ABCB7
• Gene ID (NCBI): 22
• RRID: AB_2220945
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75027
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ABCB7 belongs to the ATP-binding cassette (ABC) transporter superfamily. ABCB7 exports glutathione-coordinated iron-sulfur clusters from the mitochondria to the cytosol in an ATP-dependent manner allowing the assembly of the cytosolic iron-sulfur-containing proteins and participates in iron homeostasis(PMID: 33157103, 17192393). ABCB7 structure and mutation causing X- linked sideroblastic anemia and ataxia (XLSA/A) with disruption of cytosolic iron-sulfur protein maturation (PMID: 10196363,11050011).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Elife; Augmenter of liver regeneration regulates cellular iron homeostasis by modulating mitochondrial transport of ATP-binding cassette B8.; Authors - Hsiang-Chun Chang
human	WB	Arch Biochem Biophys; Knockdown of ABCB7 inhibits esophageal cancer progression by inhibiting the TGF-β/Smad signaling; Authors - Shiyun Feng ; KD Validated
mouse	WB	Cell Signal; Ophiopogonis japonicus polysaccharide inhibits oxidative stress in hepatocytes by promoting Runx3 in nonalcoholic fatty liver disease.; Authors - Xiuchun Zhang
human	WB	Cancer Lett; Hinokitiol preferentially suppresses metastatic lung adenocarcinoma via TMDD1-mediated ferroptosis induction and iron-sulfur cluster inhibition.; Authors - Yanbin Kuang
human	WB	Mol Cell; Dual regulation of SLC25A39 by AFG3L2 and iron controls mitochondrial glutathione homeostasis; Authors - Xiaojian Shi