ABCC5 Recombinant monoclonal antibody

ABCC5 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 84204-5-RR
Clone No.241380G1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

MRP5, MOAT C, EC:7.6.2.-, ATP-binding cassette sub-family C member 5, ABCC 5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMCF-7 cells, A549 cells, HepG2 cells
Positive IHC detected inhuman ovary cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inPC-3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:125-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84204-5-RR targets ABCC5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag31680

Product name: Recombinant human ABCC5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-179 aa of NM_005688

Sequence: MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRL

Predict reactive species
Full Name ATP-binding cassette, sub-family C (CFTR/MRP), member 5
Calculated Molecular Weight 161 kDa
Observed Molecular Weight161-200 kDa
GenBank Accession NumberNM_005688
Gene Symbol ABCC5
Gene ID (NCBI) 10057
RRIDAB_3671760
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDO15440
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ABCC5, also named MOAT-C, pABC11, SMRP, and MRP5, belongs to the ABC transporter superfamily, ABCC family, and Conjugate transporter (TC 3.A.1.208) subfamily. ABCC5 acts as a multispecific organic anion pump that can transport nucleotide analogs. ABCC5 functions in the cellular export of its substrate, cyclic nucleotides. This export contributes to the degradation of phosphodiesterases and possibly an elimination pathway for cyclic nucleotides. Studies show that ABCC5 provides resistance to thiopurine anticancer drugs, 6-mercaptopurine and thioguanine, and the anti-HIV drug 9-(2-phosphonylmethoxyethyl) adenine. ABCC5 may be involved in resistance to thiopurines in acute lymphoblastic leukemia and antiretroviral nucleoside analogs in HIV-infected patients. Alternative splicing of this gene has been detected; however, the complete sequence and translation initiation site are unclear. Since it is glycosylated, the apparent molecular weight of ABCC5 could be variable, ranging from 161 kDa to 200 kDa (PMID: 10893247; PMID: 15897250; PMID: 31338999).

Protocols

Product Specific Protocols
IF protocol for ABCC5 antibody 84204-5-RRDownload protocol
IHC protocol for ABCC5 antibody 84204-5-RRDownload protocol
WB protocol for ABCC5 antibody 84204-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...