ABCG8 Polyclonal antibody

• 

  WB analysis using 24453-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24453-1-AP (ABCG8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

ABCG8 Polyclonal Antibody for WB, ELISA

Cat No. 24453-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, rat and More (1)

Applications

WB, ELISA

Synonyms

ABCG8, GBD4, Sterolin 2, STSL

---

Tested Applications

• Positive WB detected in: HL-60 cells, PC-12 cells, k-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

24453-1-AP targets ABCG8 in WB, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Cited Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19879

  Product name: Recombinant human ABCG8 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 21-386 aa of BC113657

  Sequence: SGLQDRLFSSESDNSLYFTYSGQPNTLEVRDLNYQVDLASQVPWFEQLAQFKMPWTSPSCQNSCELGIQNLSFKVRSGQMLAIIGSSGCGRASLLDVITGRGHGGKIKSGQIWINGQPSSPQLVRKCVAHVRQHNQLLPNLTVRETLAFIAQMRLPRTFSQAQRDKRVEDVIAELRLRQCADTRVGNMYVRGLSGGERRRVSIGVQLLWNPGILILDEPTSGLDSFTAHNLVKTLSRLAKGNRLVLISLHQPRSDIFRLFDLVLLMTSGTPIYLGAAQHMVQYFTAIGYPCPRYSNPADFYVDLTSIDRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETKDLDEDTCVESSVTPLDTNCL

• Full Name: ATP-binding cassette, sub-family G (WHITE), member 8
• Calculated Molecular Weight: 673 aa, 76 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC113657
• Gene Symbol: ABCG8
• Gene ID (NCBI): 64241
• RRID: AB_3085735
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H221
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ABCG8(ATP-binding cassette sub-family G member 8) and ABCG5(ATP-binding cassette protein G5) are members of the ABC transporter family and are half-type ABC transporters, which consist of six transmembrane helices and one nucleotide-binding domain. ABCG5 and ABCG8 form a heterodimer (ABCG5/ABCG8). Mutations in either ABCG5 or ABCG8 cause a genetic disorder, sitosterolemia. Patients with sitosterolemia show high plant sterol levels and develop hypercholesterolemia and atherosclerosis at a young age.(PMID: 36839356)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Naunyn Schmiedebergs Arch Pharmacol; Molecular mechanism of geniposide against ANIT-induced intrahepatic cholestasis by integrative analysis of transcriptomics and metabolomics; Authors - Junyi Zhang
mouse	WB	Drug Des Devel Ther; Baolier Capsule's Secret Weapon: Piperine Boosts Cholesterol Excretion to Combat Atherosclerosis; Authors - Mengqiu Wei