Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
32439-1-AP targets ABHD17A in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag36531 Product name: Recombinant human FAM108A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 32-115 aa of BC000158 Sequence: EATYSLVPEPEPGPGGAGAAPLGTLRASSGAPGRWKLHLTERADFQYSQRELDTIEVFPTKSARGNHVSCMYVRCVPGARYTVL Predict reactive species |
| Full Name | family with sequence similarity 108, member A1 |
| Calculated Molecular Weight | 34 kDa |
| Observed Molecular Weight | 34 kDa |
| GenBank Accession Number | BC000158 |
| Gene Symbol | ABHD17A |
| Gene ID (NCBI) | 81926 |
| RRID | AB_3742611 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q96GS6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Alpha/beta hydrolase domain-containing protein 17A (ABHD17A), also known as FAM108A, is a membrane-localized thioesterase, which regulates H- and N-RAS39, also catalyzes the depalmitoylation of CNAβ1 causing it to redistribute from the PM to the cytosol and the Golgi (PMID: 34663815). ABHD17a is a major acyl protein thioesterase that site-specifically deacylates the STREX domain of the BK channel to control channel activity (PMID: 32913120). Western blot analysis detected ABHD17A at an apparent molecular mass of 34 kDa (PMID: 27307232), and the 70 kDa-band could be the dimer.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ABHD17A antibody 32439-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

