ABLIM3 Polyclonal antibody

• 

  WB analysis using 27981-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27981-1-AP (ABLIM3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 27981-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 27981-1-AP (ABLIM3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

ABLIM3 Polyclonal Antibody for WB, ELISA

Cat No. 27981-1-AP

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse

Applications

WB, ELISA

Synonyms

abLIM 3, ABLIM3, Actin binding LIM protein 3, HMFN1661, KIAA0843

---

Tested Applications

• Positive WB detected in: NIH/3T3 cells, mouse brain tissue, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

27981-1-AP targets ABLIM3 in WB, ELISA applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27578

  Product name: Recombinant human ABLIM3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 336-536 aa of BC001665

  Sequence: YYRSGDLSTATKSKTSEDISQTSKYSPIYSPDPYYASESEYWTYHGSPKVPRARRFSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYADPWTPPRSSTSSREALHTAGYEMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRTPSADLFHYDSMNAVNWGMREYKIYPYELLLVTTRGRNRLPKDVDRTRLEG

• Full Name: actin binding LIM protein family, member 3
• Calculated Molecular Weight: 78 kDa
• Observed Molecular Weight: 78 kDa
• GenBank Accession Number: BC001665
• Gene Symbol: ABLIM3
• Gene ID (NCBI): 22885
• RRID: AB_2881029
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O94929
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Mol Biol Cell; Spatial proximity of proteins surrounding zyxin under force-bearing conditions.; Authors - Joleen S Cheah

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Joleen (Verified Customer) (05-29-2019)

It works on western blot with a prominent band and little background.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1k
• Cell Tissue Type: MDCK GII

ABLIM3 Antibody Western Blot, validation (1:1k dilution) in MDCK GII (Cat no:27981-1-AP)