ABP1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ABP1 Polyclonal antibody (16338-1-AP)

• Featured Product
• KD/KO Validated

ABP1 Polyclonal Antibody for IHC, ELISA

Cat No. 16338-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

DAO, AOC1, Amine oxidase copper domain-containing protein 1, Amiloride-binding protein 1, Amiloride-binding protein

• 

  IHC staining of human kidney using 16338-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16338-1-AP (ABP1 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 16338-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16338-1-AP (ABP1 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 16338-1-AP

  Immunohistochemical analysis of paraffin-embedded Colorectal cancer slide using 16338-1-AP (ABP1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 16338-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 16338-1-AP (ABP1 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 16338-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 16338-1-AP (ABP1 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ABP1 in ?

Chat with Able

---

Tested Applications

• Positive IHC detected in: human kidney tissue, human colon cancer tissue, human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16338-1-AP targets ABP1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9492

  Product name: Recombinant human ABP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 400-751 aa of BC014093

  Sequence: TFHYYDADDPVHYPRALCLFEMPTGVPLRRHFNSNFKGGFNFYAGLKGQVLVLRTTSTVYNYDYIWDFIFYPNGVMEAKMHATGYVHATFYTPEGLRHGTRLHTHLIGNIHTHLVHYRVDLDVAGTKNSFQTLQMKLENITNPWSPRHRVVQPTLEQTQYSWERQAAFRFKRKLPKYLLFTSPQENPWGHKRSYRLQIHSMADQVLPPGWQEEQAITWARYPLAVTKYRESELCSSSIYHQNDPWDPPVVFEQFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNFFPEDPSLASRDTVIVWPRDNGPNYVQRWIPEDRDCSMPPPFSYNGTYRPV

• Full Name: amiloride binding protein 1 (amine oxidase (copper-containing))
• Calculated Molecular Weight: 751 aa, 85 kDa
• Observed Molecular Weight: 85 kDa
• GenBank Accession Number: BC014093
• Gene Symbol: ABP1
• Gene ID (NCBI): 26
• RRID: AB_2878245
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P19801
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The ABP1 polyclonal antibody (Cat# 16338-1-AP) has 3 total citations. These appear in Frontiers in Pharmacology, Cancer Management and Research, and Sheng Wu Yi Xue Gong Cheng Xue Za Zhi. The associated research fields include photodynamic therapy for ulcerative colitis, tumor progression in gastric cancer via AKT/EMT pathways, and AOC1's role in lipid metabolism. Applications cited are WB and IF, with species covering human and mouse.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Front Pharmacol; Photodynamic Therapy of Novel Photosensitizer Ameliorates TNBS-Induced Ulcerative Colitis via Inhibition of AOC1.; Authors - Yumei Rong ; KD Validated
human	WB	Cancer Manag Res; AOC1 Contributes to Tumor Progression by Promoting the AKT and EMT Pathways in Gastric Cancer.; Authors - Fen Xu ; KD Validated
mouse	WB	Sheng Wu Yi Xue Gong Cheng Xue Za Zhi; [Functional study of amine oxidase copper-containing 1 (AOC1) in lipid metabolism]; Authors - Siting Xiang ; KD Validated