Tested Applications
| Positive WB detected in | SH-SY5Y cells, U-251 cells, mouse brain tissue, rat brain tissue |
| Positive IHC detected in | rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IF | See 2 publications below |
Product Information
29350-1-AP targets ABR in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29522 Product name: Recombinant human ABR protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-87 aa of NM_021962 Sequence: MEPLSHRGLPRLSWIDTLYSNFSYGTDEYDGEGNEEQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGK Predict reactive species |
| Full Name | active BCR-related gene |
| Calculated Molecular Weight | 98 kDa |
| Observed Molecular Weight | 97-100 kDa |
| GenBank Accession Number | NM_021962 |
| Gene Symbol | ABR |
| Gene ID (NCBI) | 29 |
| RRID | AB_3086122 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q12979 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ABR (Active breakpoint cluster region-related protein) is the only protein known in humans and mice to share high homology with BCR (68% amino acid identity). BCR(Breakpoint cluster region) gene was originally identified due to its involvement in a specific chromosomal translocation that causes the development of chronic myeloid leukemia and a subset of acute lymphoblastic leukemia. The C-terminus is a GTPase-activating protein domain which stimulates GTP hydrolysis by RAC1, RAC2 and CDC42. (PMID: 17116687, PMID: 37507586)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ABR antibody 29350-1-AP | Download protocol |
| WB protocol for ABR antibody 29350-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Methods Connectome-seq: high-throughput mapping of neuronal connectivity at single-synapse resolution via barcode sequencing. | ||
bioRxiv Connectome-seq: High-throughput Mapping of Neuronal Connectivity at Single-Synapse Resolution via Barcode Sequencing. |







