ACAA1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• ACAA1 Recombinant monoclonal antibody (87969-1-RR)

• 

  WB analysis using 87969-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87969-1-RR (ACAA1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 87969-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87969-1-RR (ACAA1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 87969-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87969-1-RR (ACAA1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

ACAA1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87969-1-RR

Clone No.260194F9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

3 ketoacyl CoA thiolase, peroxisomal, 3-ketoacyl-CoA thiolase, peroxisomal, ACAA, Acetyl CoA acyltransferase, Acetyl-CoA acyltransferase

---

Tested Applications

• Positive WB detected in: A549 cells, SK-BR-3 cells, U-251 cells, HuH-7 cells, mouse liver tissue, rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87969-1-RR targets ACAA1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2972

  Product name: Recombinant human ACAA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 117-424 aa of BC011977

  Sequence: STVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN

• Full Name: acetyl-Coenzyme A acyltransferase 1
• Calculated Molecular Weight: 424 aa, 44 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC011977
• Gene Symbol: ACAA1
• Gene ID (NCBI): 30
• RRID: AB_3745839
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P09110
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACAA1 (acetyl-CoA acyltransferase 1) is an enzyme involved in lipid β-oxidation and provides substrates to the tricarboxylic acid (TCA) cycle, a critical step in cellular metabolism (PMID:33194642). ACAA1 is also a biomarker in type 2 diabetes (T2D), predicting the pre-diabetic metabolic signature in mouse models (PMID:25784953). Moreover, ACAA1 is highly expressed in TNBC, serving as a potential therapeutic target in ACAA1-high tumors and a predictive biomarker of resistance to CDK4/6 inhibitors for RB1-proficient patients (PMID:37129951).