ACAD11 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ACAD11 Polyclonal antibody (16997-1-AP)

• 

  WB analysis using 16997-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16997-1-AP (ACAD11 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 16997-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16997-1-AP (ACAD11 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse kidney using 16997-1-AP

  IP result of anti-ACAD11 (IP:16997-1-AP, 4ug; Detection:16997-1-AP 1:3000) with mouse kidney tissue lysate 2040 ug.

ACAD11 Polyclonal Antibody for WB, IP, ELISA

Cat No. 16997-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

ACAD 11, ACAD-11, Acyl-CoA dehydrogenase family member 11, EC:1.3.8.-

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, rat kidney tissue
• Positive IP detected in: mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16997-1-AP targets ACAD11 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10689

  Product name: Recombinant human ACAD11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 188-538 aa of BC019607

  Sequence: VEGLWNLFLPAVSGLSHVDYALIAEETGKCFFAPDVFNCQAPDTGNMEVLHLYGSEEQKKQWLEPLLQGNITSCFCMTEPDVASSDATNIECSIQRDEDSYVINGKKWWSSGAGNPKCKIAIVLGRTQNTSLSRHKQHSMILVPMNTPGVKIIRPLSVFGYTDNFHGGHFEIHFNQVRVPATNLILGEGRGFEISQGRLGPGRIHHCMRTVGLAERALQIMCERATQRIAFKKKLYAHEVVAHWIAESRIAIEKIRLLTLKAAHSMDTLGSAGAKKEIAMIKVAAPRAVSKIVDWAIQVCGGAGVSQDYPLANMYAITRVLRLADGPDEVHLSAIATMELRDQAKRLTAKI

• Full Name: acyl-Coenzyme A dehydrogenase family, member 11
• Calculated Molecular Weight: 780 aa, 87 kDa
• Observed Molecular Weight: 85 kDa
• GenBank Accession Number: BC019607
• Gene Symbol: ACAD11
• Gene ID (NCBI): 84129
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q709F0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACAD11 (Acyl-CoA Dehydrogenase Family Member 11) is a mitochondrial enzyme protein belonging to the acyl-CoA dehydrogenase (ACAD) superfamily. It participates in the mitochondrial fatty acid β-oxidation metabolic pathway, catalyzing the dehydrogenation of long-chain fatty acyl-CoA. ACAD11 is one of the key enzymes for long-chain fatty acid oxidation; its functional deficiency can lead to fatty acid metabolism disorders and insufficient energy supply. In addition, ACAD11 is involved in lipid metabolism regulation and cellular energy homeostasis maintenance, and its abnormal expression is associated with metabolic diseases such as obesity, insulin resistance, and non-alcoholic fatty liver disease. Studies have shown that ACAD11 may play a protective role in neurodegenerative diseases, participating in neuronal energy metabolism and oxidative stress defense.