ACAD8 Polyclonal antibody

• 

  WB analysis of mouse pancreas using 16742-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 16742-1-AP (ACAD8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 16742-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 16742-1-AP (ACAD8 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 16742-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 16742-1-AP (ACAD8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

ACAD8 Polyclonal Antibody for WB, ELISA

Cat No. 16742-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

ACAD 8, ACAD8, ARC42, IBD

---

Tested Applications

• Positive WB detected in: mouse pancreas tissue, mouse lung tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16742-1-AP targets ACAD8 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9967

  Product name: Recombinant human ACAD8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-415 aa of BC001964

  Sequence: MLWSGCRRFGARLGCLPGGLRVLVQTGHRSLTSCIDPSMGLNEEQKEFQKVAFDFAAREMAPNMAEWDQKELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKFCPPLCTMEKFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVVMCRTGGLGPKGISCIVVEKGTPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRINIASCSLGAAHASVILTRDHLNVRKQFGEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVALCSMAKLFATDECFAICNQALQMHGGYGYLKDYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE

• Full Name: acyl-Coenzyme A dehydrogenase family, member 8
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC001964
• Gene Symbol: ACAD8
• Gene ID (NCBI): 27034
• RRID: AB_2219559
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UKU7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The acyl-CoA dehydrogenases (ACAD) (EC 1.3.99) are a family of nuclear-encoded mitochondrial enzymes involved in the metabolism of fatty acids and branched chain amino acids (PMID: 13295225). The eighth member of this family, ACAD8, catalyzes the conversion of isobutyryl-CoA to methacrylyl-CoA in valine catabolism (PMID: 12359132). ACAD8, also named as acyl-Coenzyme A dehydrogenase family, member 8, has 3 isoform which molecular weight is 45, 31 and 38 kDa.