ACBD4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ACBD4 Polyclonal antibody (20941-1-AP)

ACBD4 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 20941-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF/ICC, ELISA

Synonyms

HMFT0700, Acyl-CoA-binding domain-containing protein 4

• 

  WB analysis of human kidney using 20941-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 20941-1-AP (ACBD4 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 20941-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using ACBD4 antibody (20941-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ACBD4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human kidney tissue
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20941-1-AP targets ACBD4 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15045

  Product name: Recombinant human ACBD4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 73-305 aa of BC029164

  Sequence: WNSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVGAVSEPPCLPKEPAPPSPESHSPRDLDSEVFCDSLEQLEPELVWTEQRAASGGKRDPRNSPVPPTKKEGLRGSPPGPQELDVWLLGTVRALQESMQEVQARVQSLESMPRPPEQRPQPRPSARPWPLGLPGPALLFFLLWPFVVQWLFRMFRTQKR

• Full Name: acyl-Coenzyme A binding domain containing 4
• Calculated Molecular Weight: 341 aa, 38 kDa
• Observed Molecular Weight: 30-38 kDa
• GenBank Accession Number: BC029164
• Gene Symbol: ACBD4
• Gene ID (NCBI): 79777
• RRID: AB_2878769
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NC06
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The ACBD4 Polyclonal antibody (Cat# 20941-1-AP) has 1 citation. It was cited in Nature Structural & Molecular Biology (2021), in a study investigating how TDP-43 aggregation induced by oxidative stress causes global mitochondrial imbalance in ALS. The research field encompasses neurodegenerative disease (ALS), oxidative stress, and mitochondrial biology. The antibody was used for Western blot in mouse samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Struct Mol Biol; TDP-43 aggregation induced by oxidative stress causes global mitochondrial imbalance in ALS.; Authors - Xinxin Zuo