ACBD7 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ACBD7 Polyclonal antibody (33855-1-AP)

• 

  WB analysis using 33855-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33855-1-AP (ACBD7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

ACBD7 Polyclonal Antibody for WB, ELISA

Cat No. 33855-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Acyl-CoA-binding domain-containing protein 7

---

Tested Applications

• Positive WB detected in: Jurkat cells, SH-SY5Y cells, SK-N-SH cells, U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33855-1-AP targets ACBD7 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag40829

  Product name: Recombinant human ACBD7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-88 aa of BC029526

  Sequence: MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELIEKYGI

• Full Name: acyl-Coenzyme A binding domain containing 7
• Calculated Molecular Weight: 88 aa, 10 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC029526
• Gene Symbol: ACBD7
• Gene ID (NCBI): 414149
• RRID: AB_3743096
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8N6N7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACBD7 encodes acyl-CoA binding domain-containing protein 7, a small fatty-acyl-CoA-binding protein linked to fatty acid metabolism. It is predicted to function upstream of processes including energy homeostasis, leptin-mediated signaling, and the response to food, placing it within metabolic control rather than a broadly acting structural or signaling role. Expression measurements show detectable levels in brain, where both RNA and protein are reported.