• Featured Product
  • KD/KO Validated

CoraLite®555-conjugated ACC1 Monoclonal antibody

ACC1 Monoclonal Antibody for IF/ICC
Cat No. CL555-67373
Clone No.1A11G10

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse, Rat

Applications

IF/ICC

ACAC, ACACA, ACC, ACC1, ACCA, Acetyl CoA carboxylase 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL555-67373 targets ACC1 in IF/ICC applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17503

Product name: Recombinant human ACC protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 2260-2383 aa of BC137287

Sequence: LLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLAEWLEKQLTEEDGVHSVIEENIKCISRDYVLKQIRSLVQANPEVAMDSIIHMTQHISPTQRAEVIRILSTMDSPST

Predict reactive species
Full Name acetyl-Coenzyme A carboxylase alpha
Calculated Molecular Weight 2383 aa, 275 kDa
Observed Molecular Weight 260-270 kDa
GenBank Accession NumberBC137287
Gene Symbol Acetyl-CoA Carboxylase 1
Gene ID (NCBI) 31
RRIDAB_3084629
Conjugate CoraLite®555 Fluorescent Dye
Excitation/Emission Maxima Wavelengths557 nm / 570 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13085
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

ACACA(Acetyl-CoA carboxylase 1, ACC), also named as ACAC, ACC1 and ACCA, belongs to the biotin containing enzyme family. It catalyzes the synthesis of malonyl-CoA, which is an intermediate substrate playing a pivotal role in the regulation of fatty acid metabolism and energy production. ACACA is involved in the biosynthesis of fatty acids, and malonyl-CoA produced is used as a building block to extend the chain length of fatty acids by fatty acid synthase (FAS)(PMID:19900410). It has 4 isoforms produced by alternative promoter usage with the molecular weight between 260 kDa and 270 kDa.

Protocols

Product Specific Protocols
IF protocol for CL555 ACC1 antibody CL555-67373Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...