ASIC4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ASIC4 Polyclonal antibody (12003-1-AP)

ASIC4 Polyclonal Antibody for WB, ELISA

Cat No. 12003-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

ACCN4, Acid sensing ion channel 4, ASIC4, BNAC4

• 

  WB analysis of A375 using 12003-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 12003-1-AP (ASIC4 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ASIC4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A375 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12003-1-AP targets ASIC4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2664

  Product name: Recombinant human ACCN4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 299-647 aa of BC010439

  Sequence: QLADMLKSCNFSGHHCSASNFSVVYTRYGKCYTFNADPRSSLPSRAGGMGSGLEIMLDIQQEEYLPIWRETNETSFEAGIRVQIHSQEEPPYIHQLGFGVSPGFQTFVSCQEQRLTYLPQPWGNCRAESELREPELQGYSAYSVSACRLRCEKEAVLQRCHCRMVHMPDSLGGGPEGPCFCPTPCNLTRYGKEISMVRIPNRGSARYLARKYNRNETYIRENFLVLDVFFEALTSEAMEQRAAYGLSALLGDLGGQMGLFIGASILTLLEILDYIYEVSWDRLKRVWRRPKTPLRTSTGGISTLGLQELKEQSPCPSLGRAEGGGVSSLLPNHHHPHGPPGGLFEDFAC

• Full Name: amiloride-sensitive cation channel 4, pituitary
• Calculated Molecular Weight: 647 aa, 70 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC010439
• Gene Symbol: ASIC4
• Gene ID (NCBI): 55515
• RRID: AB_2242283
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96FT7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The ASIC4 Polyclonal antibody (Cat# 12003-1-AP) has 1 total citation. It appears in Aging (Albany NY) (2021), where it was used for Western blot in a study investigating how ASIC1 and ASIC3 mediate cellular senescence of human nucleus pulposus mesenchymal stem cells during intervertebral disc degeneration. The associated research fields include cellular senescence, mesenchymal stem cell biology, and intervertebral disc degeneration.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Aging (Albany NY); ASIC1 and ASIC3 mediate cellular senescence of human nucleus pulposus mesenchymal stem cells during intervertebral disc degeneration.; Authors - Jingyu Ding