PHACS Polyclonal antibody

• 

  WB analysis of MDA-MB-453s using 11491-1-AP

  MDA-MB-453s cells were subjected to SDS PAGE followed by western blot with 11491-1-AP (PHACS antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 11491-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11491-1-AP (PHACS antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 11491-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 11491-1-AP (PHACS antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 11491-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 11491-1-AP (PHACS antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 11491-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 11491-1-AP (PHACS antibody) at dilution of 1:50 (under 40x lens).

PHACS Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11491-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

ACC synthase like protein 1, ACCS, ACS, PHACS

---

Tested Applications

• Positive WB detected in: MDA-MB-453s cells, HeLa cells, mouse testis tissue
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11491-1-AP targets PHACS in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2056

  Product name: Recombinant human ACCS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 152-501 aa of BC020197

  Sequence: YCKSPVPLRPENVVVLNGGASLFSALATVLCEAGEAFLIPTPYYGAITQHVCLYGNIRLAYVYLDSEVTGLDTRPFQLTVEKLEMALREAHSEGVKVKGLILISPQNPLGDVYSPEELQEYLVFAKRHRLHVIVDEVYMLSVFEKSVGYRSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGTLYTENQDVATAVASLCRYHGLSGLVQYQMAQLLRDRDWINQVYLPENHARLKAAHTYVSEELRALGIPFLSRGAGFFIWVDLRKYLLKGTFEEEMLLWRRFLDNKVLLSFGKAFECKEPGWFRFVFSDQVHRLCLGMQRVQQVLAGKSQVAEDPRPSQSQEPSDQRR

• Full Name: 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional)
• Calculated Molecular Weight: 501 aa, 57 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC020197
• Gene Symbol: PHACS
• Gene ID (NCBI): 84680
• RRID: AB_2222681
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96QU6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACCS(1-aminocyclopropane-1-carboxylate synthase-like protein 1) is also named as PHACS and belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family. The deduced 501-amino acid protein has a calculated molecular mass of 58 kD. It contains overlapping aminotransferase I and beta-eliminating lyase domains, and it shares structural similarity with aspartate aminotransferase, tyrosine aminotransferase, and enzymes that catalyze beta-elimination reactions on amino acids.