ACF1 Monoclonal antibody, PBS Only

• 

  WB analysis using 67947-1-Ig (same clone as 67947-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67947-1-Ig (ACF1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67947-1-PBS in a different storage buffer formulation.

ACF1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67947-1-PBS

Clone No.1C4F8

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

ACF1/BAZ1A, BAZ1A, 1C4F8, ATP-dependent chromatin-remodeling protein, ATP-utilizing chromatin assembly and remodeling factor 1

---

Product Information

67947-1-PBS targets ACF1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30607

  Product name: Recombinant human ACF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of NM_013448

  Sequence: MPLLHRKPFVRQKPPADLRPDEEVFYCKVTNEIFRHYDDFFERTILCNSLVWSCAVTGRPGLTYQEALESEKKARQNLQSFPEPLIIPVLYLTSLTHRSRLHEICDDIFAYVKDRYFVEETVEVIRNNGARLQCRILEVLPPSHQNGFANGHVNSVDGETIIISDSDDSETQSCSFQNGKKKDAIDPLLFKYKVQPTKKE

• Full Name: bromodomain adjacent to zinc finger domain, 1A
• Calculated Molecular Weight: 179 kDa
• Observed Molecular Weight: 180 kDa
• GenBank Accession Number: NM_013448
• Gene Symbol: BAZ1A
• Gene ID (NCBI): 11177
• RRID: AB_2918699
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NRL2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.