ACMSD Polyclonal antibody

• 

  IHC staining of mouse kidney using 26834-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 26834-1-AP (ACMSD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 26834-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 26834-1-AP (ACMSD antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ACMSD Polyclonal Antibody for IHC, ELISA

Cat No. 26834-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

Synonyms

ACMSD, Picolinate carboxylase

---

Tested Applications

• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26834-1-AP targets ACMSD in IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25230

  Product name: Recombinant human ACMSD protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 47-252 aa of BC016018

  Sequence: VSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELEPGKLIESMEE

• Full Name: aminocarboxymuconate semialdehyde decarboxylase
• Calculated Molecular Weight: 38 kDa
• GenBank Accession Number: BC016018
• Gene Symbol: ACMSD
• Gene ID (NCBI): 130013
• RRID: AB_3085909
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TDX5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACMSD (alpha-amino-beta-carboxy-muconate-semialdehyde decarboxylase ) is the key enzyme that regulates the de novo NAD+ synthesis from tryptophan. ACMSD is highly expressed in the liver, kidney and to a lower degree in brain under physiological conditions. The enzyme is primarily cytosolic and is positioned at a critical branching point in the kynurenine pathway, wherein it influences the fate of the precursor 2-amino-3-carboxymuconic-6-semialdehyde (ACMS).