Tested Applications
| Positive WB detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20410-1-AP targets ACN9 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14242 Product name: Recombinant human ACN9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 28-125 aa of BC022858 Sequence: KSLGDQYVKDEFRRHKTVGSDEAQRFLQEWEVYATALLQQANENRQNSTGKACFGTFLPEEKLNDFRDEQIGQLQELMQEATKPNRQFSISESMKPKF Predict reactive species |
| Full Name | ACN9 homolog (S. cerevisiae) |
| Calculated Molecular Weight | 125 aa, 15 kDa |
| Observed Molecular Weight | 15 kDa |
| GenBank Accession Number | BC022858 |
| Gene Symbol | ACN9 |
| Gene ID (NCBI) | 57001 |
| RRID | AB_3085604 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NRP4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ACN9 antibody 20410-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

