Aconitase 2 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Aconitase 2 Recombinant monoclonal antibody (87630-2-RR)

Aconitase 2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87630-2-RR

Clone No.252976A4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

ACO2, ACO 2, Aconitase, Aconitase2, Citrate hydro-lyase

• 

  WB analysis using 87630-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87630-2-RR (ACO2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 87630-2-RR

  Biolayer interferometry (BLl) kinetic assays of 87630-2-RR against Human ACO2 were performed. The affinity constant is below 1 pM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells, K-562 cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87630-2-RR targets Aconitase 2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1590

  Product name: Recombinant human ACO2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-306 aa of BC014092

  Sequence: MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWKPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWSSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKY

• Full Name: aconitase 2, mitochondrial
• Calculated Molecular Weight: 85 kDa
• Observed Molecular Weight: 85 kDa
• GenBank Accession Number: BC014092
• Gene Symbol: ACO2
• Gene ID (NCBI): 50
• RRID: AB_3745662
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q99798
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACO2(aconitate hydratase, mitochondrial) is also named as citrate hydro-lyase and belongs to the aconitase/IPM isomerase family. It plays a key function in cellular energy production, and loss of its activity has a major impact on cellular and organismal survival.