ACOT12 Polyclonal antibody

ACOT12 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 17871-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, IF/ICC, ELISA

Acetyl-coenzyme A thioesterase, ACOT 12, Acyl-CoA thioester hydrolase 12, Acyl-CoA thioesterase 12, Acyl-coenzyme A thioesterase 12

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, HuH-7 cells, rat liver tissue
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inU2OS cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17871-1-AP targets ACOT12 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12355

Product name: Recombinant human ACOT12 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 206-555 aa of BC075011

Sequence: MAWMETVATISASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAIVNNTFQTCVEVGVRVEAFDCQEWAEGRGRHINSAFLIYNAADDKENLITFPRIQPISKDDFRRYRGAIARKRIRLGRKYVISHKEEVPLCIHWDISKQASLSDSNVEALKKLAAKRGWEVTSTVEKIKIYTLEEHDVLSVWVEKHVGSPAHLAYRLLSDFTKRPLWDPHFVSCEVIDWVSEDDQLYHITCPILNDDKPKDLVVLVSRRKPLKDGNTYTVAVKSVILPSVPPSPQYIRSEIICAGFLIHAIDSNSCIVSYFNHMSASILPYFAGNLGGWSKSIEETAASCIQFLENPPDDGFVSTF

Predict reactive species
Full Name acyl-CoA thioesterase 12
Calculated Molecular Weight 555 aa, 62 kDa
Observed Molecular Weight 70 kDa
GenBank Accession NumberBC075011
Gene Symbol ACOT12
Gene ID (NCBI) 134526
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8WYK0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACOT12 is an acyl-coenzyme A thioesterase that hydrolyzes acyl-coenzyme A (acyl-CoA) to free fatty acids and coenzyme A, thereby regulating intracellular levels of acyl-CoA and free fatty acids. It plays a key role in lipid metabolism and is mainly expressed in the kidney, liver, and intestine. ACOT12 plays an important role in a variety of diseases, including renal fibrosis, nonalcoholic fatty liver disease (NAFLD), and hepatocellular carcinoma. In renal fibrosis, downregulation of ACOT12 expression leads to lipid accumulation and exacerbates the fibrotic process. Restoration of its expression ameliorates renal fibrosis, suggesting that ACOT12 is a potential therapeutic target.

Protocols

Product Specific Protocols
WB protocol for ACOT12 antibody 17871-1-APDownload protocol
IHC protocol for ACOT12 antibody 17871-1-APDownload protocol
IF protocol for ACOT12 antibody 17871-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

J Orthop Res

Development of a mouse model of knee osteoarthritis based on obesity and bipedal walking.

Authors - Kyeong Min Son
Loading...
||
New chat Able
正在加载,请稍候...