Use Able AI chat for product recommendations

ACRV1 Polyclonal antibody

ACRV1 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF/ICC, IF-P, IP, ELISA

Acrosomal protein SP 10, Acrosomal protein SP-10, acrosomal vesicle protein 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for ACRV1 in ?

Tested Applications

Positive WB detected inDU 145 cells, LNCaP cells, PC-3 cells
Positive IP detected inDU 145 cells
Positive IHC detected inhuman testis tissue, mouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse testis tissue
Positive IF/ICC detected inPC-3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14040-1-AP targets ACRV1 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivitymouse, rat, hamster
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5109

Product name: Recombinant human ACRV1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-265 aa of BC014588

Sequence: MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI

Predict reactive species
Full Name acrosomal vesicle protein 1
Calculated Molecular Weight 28 kDa
Observed Molecular Weight 13-36 kDa
GenBank Accession NumberBC014588
Gene Symbol ACRV1
Gene ID (NCBI) 56
RRIDAB_10640426
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP26436
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The protein ACRV1, also known as SP-10, is an acrosomal matrix protein, which is evolutionarily conserved among mammals. It is associated with the matrix of the acrosomal vesicle in developing spermatids and the acrosomal matrix and membranes of ejaculated sperm (PMID: 8288254). Human ACRV1 protein has 11 isoforms, and molecular weight ranges from 9 to 28 kDa. ACRV1 was predominantly located in round and elongated spermatids in the testis, indicating that ACRV1 may play an important role in mammalian spermatogenesis and may be a target of a contraceptive vaccine (PMID: 21488928; 8874713).

Protocols

Product Specific Protocols
IF protocol for ACRV1 antibody 14040-1-APDownload protocol
IHC protocol for ACRV1 antibody 14040-1-APDownload protocol
IP protocol for ACRV1 antibody 14040-1-APDownload protocol
WB protocol for ACRV1 antibody 14040-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-MIWI antibody (Cat# 14040-1-AP) has 27 citations published in journals including Nature Communications, PNAS, Nucleic Acids Research, EMBO Journal, EMBO Reports, Science China Life Sciences, Environmental Science & Technology, Archives of Toxicology, Cell Mol Life Sci, Communications Biology, iScience, PLoS Genetics, and others. Research fields center on spermatogenesis, piRNA biogenesis, male fertility, testicular development, acrosome biogenesis, mitochondrial compartmentalization in germ cells, and environmental toxicology effects on reproduction.

SpeciesApplicationTitle
mouseIF

Nat Commun

TDRD5 binds piRNA precursors and selectively enhances pachytene piRNA processing in mice.

Authors - Deqiang Ding
mouseIF

Nat Commun

SYPL1 defines a vesicular pathway essential for sperm cytoplasmic droplet formation and male fertility

Authors - Jiali Liu
mouseIF

Nat Commun

piRNA loading triggers MIWI translocation from the intermitochondrial cement to chromatoid body during mouse spermatogenesis

Authors - Huan Wei
mouseIF

Nucleic Acids Res

Mitochondrial membrane-based initial separation of MIWI and MILI functions during pachytene piRNA biogenesis.

Authors - Deqiang Ding
mouseIF

Environ Sci Technol

Screening and Evaluation of Male Reproductive Effects of Isothiazolinones at Human-Relevant Levels in Mammals: Direct Impairments and Increased Susceptibility to Subsequent Spermatogenic Stress

Authors - Yi-Ming Xiong
mouseIF

Arch Toxicol

Extended exposure to tetrabromobisphenol A-bis(2,3-dibromopropyl ether) leads to subfertility in male mice at the late reproductive age

Authors - Yuan-Yuan Li
Loading...
||
New chat

Able™

正在加载,请稍候...