ACSL5 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA sample test of MP03024-1

  The mean ACSL5 concentration was determined to be 219.78 ng/mL in HT-29 cell extract based on a 1.10 mg/mL extract load, 110.43 ng/mL in BxPC-3 cell extract based on a 1.20 mg/mL extract load and 29.12 ng/mL in A2780 cell extract based on a 1.20 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP03024-1

  Sandwich ELISA standard curve of MP03024-1, Human ACSL5 Recombinant Matched Antibody Pair - PBS only. 86982-4-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag8258. 86982-3-PBS was HRP conjugated as the detection antibody. Range: 0.781-50 ng/mL.

ACSL5 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA

Cat No. 86982-4-PBS

Clone No.252098F3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA

Synonyms

---

Product Information

86982-4-PBS targets ACSL5 as part of a matched antibody pair:

MP03024-1: 86982-4-PBS capture and 86982-3-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8258

  Product name: Recombinant human ACSL5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 388-739 aa of BC007985

  Sequence: DIRLLADDMKTLKPTLFPAVPRLLNRIYDKVQNEAKTPLKKFLLKLAVSSKFKELQKGIIRHDSFWDKLIFAKIQDSLGGRVRVIVTGAAPMSTSVMTFFRAAMGCQVYEAYGQTECTGGCTFTLPGDWTSGHVGVPLACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDGWLHTGDIGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIENIYNRSQPVLQIFVHGESLRSSLVGVVVPDTDVLPSFAAKLGVKGSFEELCQNQVVREAILEDLQKIGKESGLKTFEQVKAIFLHPEPFSIENGLLTPTLKAKRGELSKYFRTQIDSLYEHIQD

• Full Name: acyl-CoA synthetase long-chain family member 5
• Calculated Molecular Weight: 76 kDa
• GenBank Accession Number: BC007985
• Gene Symbol: ACSL5
• Gene ID (NCBI): 51703
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9ULC5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.