ACSM1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ACSM1 Polyclonal antibody, PBS Only (24407-1-PBS)

• 

  WB analysis using 24407-1-AP (same clone as 24407-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24407-1-AP (ACSM1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24407-1-PBS in a different storage buffer formulation.

ACSM1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24407-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

BUCS1, Butyrate CoA ligase 1, LAE, Lipoate activating enzyme, MACS1

---

Product Information

24407-1-PBS targets ACSM1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18475

  Product name: Recombinant human ACSM1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 227-383 aa of BC125178

  Sequence: SGTTGFPKMAKHSHGLALQPSFPGSRKLRSLKTSDVSWCLSDSGWIVATIWTLVEPWTAGCTVFIHHLPQFDTKVIIQTLLKYPINHFWGVSSIYRMILQQDFTSIRFPALEHCYTGGEVVLPKDQEEWKRRTGLLLYENYGQSETGLICATYWGMK

• Full Name: acyl-CoA synthetase medium-chain family member 1
• Calculated Molecular Weight: 577 aa, 65 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC125178
• Gene Symbol: ACSM1
• Gene ID (NCBI): 116285
• RRID: AB_3742113
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q08AH1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.