Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

ACSM3 Polyclonal antibody

ACSM3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

EC:6.2.1.17, Butyryl-coenzyme A synthetase 3, Butyrate--CoA ligase 3, Acyl-coenzyme A synthetase ACSM3, mitochondrial, Acyl-CoA synthetase medium-chain family member 3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for ACSM3 in ?

Tested Applications

Positive WB detected inmouse kidney tissue, HEK-293 cells, rat kidney tissue
Positive IHC detected inhuman colon cancer tissue, human prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10168-2-AP targets ACSM3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0224

Product name: Recombinant human ACSM3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-320 aa of BC002790

Sequence: MLARVTRKMLRHAKCFQRLAIFGSVRALHKDNRTATPQNFSNYESMKQDFKLGIPEYFNFAKDVLDQWTDKEKAGKKPSNPAFWWINRNGEEMRWSFEELGSLSRKFANILSEACSLQRGDRVILILPRVPEWWLANVACLRTGTVLIPGTTQLTQKDILYRLQSSKANCIITNDVLAPAVDAVASKCENLHSKLIVSENSREGWGNLKELMKHASDSHTCVKTKHNEIMAIFFTSGTSGYPKMTAHTHSSFGLGLSVNGRFWLDLTPSDVMWNTSDTGWAKSAWSSVFSPWIQGACVFTHHLPRFEPTSILQTLSKYPI

Predict reactive species
Full Name acyl-CoA synthetase medium-chain family member 3
Calculated Molecular Weight 49 kDa, 66 kDa
Observed Molecular Weight 60-70 kDa
GenBank Accession NumberBC002790
Gene Symbol ACSM3
Gene ID (NCBI) 6296
RRIDAB_2222699
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ53FZ2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SA hypertension-associated rat homolog (SAH, synonym: SA) is expressed at 10-fold greater levels in the kidney of the spontaneously hypertensive rat than in the corresponding wild-type strain. The gene is linked to blood pressure levels in a number of crosses involving the spontaneously hypertensive rat and other strains of genetically hypertensive rats. Human SAH gene polymorphism may be associated with the renal prognosis of immunoglobulin A nephropathy through its effect on blood pressure. Furthermore, variation in SAH has a role in predisposition.

Protocols

Product Specific Protocols
IF protocol for ACSM3 antibody 10168-2-APDownload protocol
IHC protocol for ACSM3 antibody 10168-2-APDownload protocol
WB protocol for ACSM3 antibody 10168-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-ACSM3 (Cat# 10168-2-AP) has 9 citations published in journals including Cell, Nature Communications, Cells, Frontiers in Pharmacology, Frontiers in Cell and Developmental Biology, Scientific Reports, European Journal of Cell Biology, Frontiers in Oncology, and Experimental & Therapeutic Medicine. Research fields span pancreatic cancer organoids, kidney allograft rejection, lupus nephritis, nephrotoxicity, ovarian cancer, hepatic lipid metabolism, Duchenne muscular dystrophy, and acute myeloid leukemia.

SpeciesApplicationTitle
mouse,humanIHC

Cell

Organoid Models of Human and Mouse Ductal Pancreatic Cancer.

Authors - Sylvia F Boj
mouse, humanIF

Nat Commun

Injured epithelial cell states impact kidney allograft survival after T-cell-mediated rejection.

Authors - Anna Maria Pfefferkorn
human, mouseIHC

Cells

The CDO1-ACSM3 Axis Mediates Renal Tubule Lipid Deposition and Injury by Causing Mitochondrial Dysfunction in Lupus Nephritis.

Authors - Zibo Zhang
mouseWB

Front Pharmacol

Delineation of renal protein profiles in aristolochic acid I-induced nephrotoxicity in mice by label-free quantitative proteomics

Authors - Xinhui Liu
humanIHC

Front Cell Dev Biol

Predicting Panel of Metabolism and Immune-Related Genes for the Prognosis of Human Ovarian Cancer.

Authors - Lingyun Zhang
mouse

Sci Rep

Thioesterase induction by 2,3,7,8-tetrachlorodibenzo-p-dioxin results in a futile cycle that inhibits hepatic β-oxidation.

Authors - Giovan N Cholico
Loading...
||
New chat

Able™

正在加载,请稍候...