ACSS3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of HepG2 using 84810-4-RR (same clone as 84810-4-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 84810-4-RR (ACSS3 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84810-4-PBS in a different storage buffer formulation.

• 

  WB analysis of THP-1 using 84810-4-RR (same clone as 84810-4-PBS)

  THP-1 cells were subjected to SDS PAGE followed by western blot with 84810-4-RR (ACSS3 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84810-4-PBS in a different storage buffer formulation.

ACSS3 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84810-4-PBS

Clone No.242423C6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

EC:6.2.1.1, Acyl-CoA synthetase short-chain family member 3, mitochondrial, Acyl-CoA synthetase short-chain family member 3, ACSS 3, Acetate--CoA ligase 3

---

Product Information

84810-4-PBS targets ACSS3 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9173

  Product name: Recombinant human ACSS3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 341-686 aa of BC009317

  Sequence: DLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLGNSKTPPPGQAGKSVPGYNVMILDDNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVNGKPYKITSTIEDPSIFGHVEEMLKQA

• Full Name: acyl-CoA synthetase short-chain family member 3
• Calculated Molecular Weight: 686 aa, 75 kDa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: BC009317
• Gene Symbol: ACSS3
• Gene ID (NCBI): 79611
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9H6R3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ACSS3(acyl-CoA synthetase short-chain family member 3, mitochondrial) belongs to the ATP-dependent AMP-binding enzyme family. It activates acetate so that it can be used for lipid synthesis or for energy generation. The deduced 686-amino acid protein contains 4 of 5 motifs characteristic of acyl-CoA synthetases. This protein has 2 isoforms produced by alternative splicing. The full length protein has a transit peptide with 29 amino acids.