ACTG2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ACTG2 Polyclonal antibody, PBS Only (31849-1-PBS)

• 

  WB analysis using 31849-1-AP (same clone as 31849-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31849-1-AP (ACTG2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31849-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 31849-1-AP (same clone as 31849-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31849-1-AP (ACTG2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31849-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse stomach using 31849-1-AP (same clone as 31849-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 31849-1-AP (ACTG2 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31849-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse stomach using 31849-1-AP (same clone as 31849-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 31849-1-AP (ACTG2 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31849-1-PBS in a different storage buffer formulation.

ACTG2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 31849-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

ACTA3, Actin, gamma-enteric smooth muscle, Actin, gamma-enteric smooth muscle, intermediate form, ACTL3, ACTSG

---

Product Information

31849-1-PBS targets ACTG2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36024

  Product name: Recombinant human ACTG2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of BC094877

  Sequence: MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPE

• Full Name: actin, gamma 2, smooth muscle, enteric
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC094877
• Gene Symbol: ACTG2
• Gene ID (NCBI): 72
• RRID: AB_3670128
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P63267
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Actin gamma 2 (ACTG2, also known as ACT, ACTE, VSCM, ACTA3, ACTL3, and ACTSG) is a highly conserved protein involved in various types of cell motility and ubiquitously expressed in all eukaryotic cells. ACTG2 mutations would cause congenital distended bladder, microcolon, and intestinal hypoperistalsis (PMID: 24337657). It also has been reported that ACTG2 promotes hepatocellular carcinoma (HCC) migration and invasion through the Notch1 signaling pathway, which might serve as a new intervention target for the treatment of HCC (PMID: 28385530).