ACTR1A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ACTR1A Polyclonal antibody, PBS Only (10357-1-PBS)

• 

  WB analysis using 10357-1-AP (same clone as 10357-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10357-1-AP (ACTR1A antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10357-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 10357-1-AP (same clone as 10357-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 10357-1-AP (ACTR1A antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10357-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 10357-1-AP (same clone as 10357-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 10357-1-AP (ACTR1A antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10357-1-PBS in a different storage buffer formulation.

ACTR1A Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 10357-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Centractin, ARP1, Alpha-centractin, Alpha centractin, Actin-RPV

---

Product Information

10357-1-PBS targets ACTR1A in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0381

  Product name: Recombinant human ACTR1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 147-368 aa of BC000693

  Sequence: LYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGA

• Full Name: ARP1 actin-related protein 1 homolog A, centractin alpha (yeast)
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 42-45 kDa
• GenBank Accession Number: BC000693
• Gene Symbol: ACTR1A
• Gene ID (NCBI): 10121
• RRID: AB_2221724
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61163
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.