ARP3/ARP3B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ARP3/ARP3B Polyclonal antibody (13822-1-AP)

• Featured Product
• KD/KO Validated

ARP3/ARP3B Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 13822-1-AP Copied!

Publications (19)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

Actin like protein 3, Actin related protein 3, ACTR3, ACTR3B, Arp11, ARP3, ARP3/ARP3B, Arp4

• 

  WB analysis using 13822-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13822-1-AP (ARP3/ARP3B antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse spleen using 13822-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 13822-1-AP (ARP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human liver using 13822-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 13822-1-AP (ARP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse spleen using 13822-1-AP

  IP result of anti-ARP3/ARP3B (IP:13822-1-AP, 4ug; Detection:13822-1-AP 1:1000) with mouse spleen tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 13822-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 13822-1-AP (ARP3/ARP3B antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ARP3/ARP3B in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, mouse spleen tissue, human liver tissue, A549 cells, HL-60 cells, HeLa cells, Jurkat cells, K-562 cells, PC-3 cells
• Positive IP detected in: mouse spleen tissue
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13822-1-AP targets ARP3/ARP3B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4922

  Product name: Recombinant human ACTR3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 156-418 aa of BC044590

  Sequence: RQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS

• Full Name: ARP3 actin-related protein 3 homolog (yeast)
• Calculated Molecular Weight: 418 aa 47 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC044590
• Gene Symbol: ARP3/ACTR3
• Gene ID (NCBI): 10096
• RRID: AB_2221967
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61158
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ARP3 (also known as ACTR3) is a major constituent of the ARP2/3 complex that is necessary for nucleating actin polymerization at filament branches. ARP3 localizes to the lamellipodia of stationary and locomoting fibroblasts. Overexpression of ARP3 has been reported in several types of cancer cells. This antibody recognizes endogenous ARP3 and may cross-react with ATCR3B.

Publications

What published studies show

The antibody Arp2/3 (Cat# 13822-1-AP) has 19 total citations. Citations appear in journals including Nature, Nature Communications, ACS Nano, Cell Death & Disease, Nat Struct Mol Biol, EMBO Reports, PLoS Genetics, Mol Cell Biol, Cell Microbiology, Int J Biol Sci, Translational Oncology, and others. Research fields span actin cytoskeleton dynamics, mitochondrial organization, cancer biology (pancreatic, hepatic, osteosarcoma, gastric, cervical), neurobiology, cell migration, blood-testis barrier integrity, renal fibrosis, and immune cell infiltration.

Automatically generated from the 19 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; Actin cables and comet tails organize mitochondrial networks in mitosis.; Authors - Andrew S Moore
human	WB	Nat Commun; An interphase actin wave promotes mitochondrial content mixing and organelle homeostasis; Authors - Stephen M Coscia
mouse	WB	Nat Commun; Compartmentalized cytoplasmic tradewinds direct soluble proteins.; Authors - Catherine G. Galbraith
rat	WB,IF	ACS Nano; Oxidation of Reduced Graphene Oxide via Cellular Redox Signaling Modulates Actin-Mediated Neurotransmission.; Authors - Yiyuan Kang
human	WB	Cell Death Dis; LINC01133 promotes pancreatic ductal adenocarcinoma epithelial-mesenchymal transition mediated by SPP1 through binding to Arp3; Authors - Yefan Yang
human	WB	Int J Biol Sci; Rictor promotes cell migration and actin polymerization through regulating ABLIM1 phosphorylation in Hepatocellular Carcinoma.; Authors - Xin Dong