ACVR1B Recombinant monoclonal antibody, PBS Only

• 

ACVR1B Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83026-1-PBS

Clone No.230260C5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

activin A receptor, type IB, Activin receptor like kinase 4, Activin receptor type 1B, Activin receptor type-1B, Activin receptor-like kinase 4

---

Product Information

83026-1-PBS targets ACVR1B in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0129

  Product name: Recombinant human ACVR1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 211-448 aa of BC000254

  Sequence: EIIGKGRFGEVWRGRWRGGDVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTIEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIADLGLAVRHDAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNSGGVHEEYQLPYYDLVPSDPSIEEMRKVVC

• Full Name: activin A receptor, type IB
• Calculated Molecular Weight: 57 kDa
• GenBank Accession Number: BC000254
• Gene Symbol: ACVR1B
• Gene ID (NCBI): 91
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P36896
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.