ACVR1B Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP00098-4

  Sandwich ELISA standard curve of MP00098-4, Human ACVR1B Recombinant Matched Antibody Pair - PBS only. 83026-4-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag0129. 83026-7-PBS was HRP conjugated as the detection antibody. Range: 1.56-100 ng/mL.

• 

  Sample test of MP00098-4

  The mean ACVR1B concentration was determined to be 40.70 ng/mL in HepG2 cell extract based on a 1.00 mg/mL extract load.

ACVR1B Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 83026-4-PBS

Clone No.230260H5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

activin A receptor, type IB, Activin receptor like kinase 4, Activin receptor type 1B, Activin receptor type-1B, Activin receptor-like kinase 4

---

Product Information

83026-4-PBS targets ACVR1B as part of a matched antibody pair:

MP00098-4: 83026-4-PBS capture and 83026-7-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0129

  Product name: Recombinant human ACVR1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 211-448 aa of BC000254

  Sequence: EIIGKGRFGEVWRGRWRGGDVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTIEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIADLGLAVRHDAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNSGGVHEEYQLPYYDLVPSDPSIEEMRKVVC

• Full Name: activin A receptor, type IB
• Calculated Molecular Weight: 57 kDa
• GenBank Accession Number: BC000254
• Gene Symbol: ACVR1B
• Gene ID (NCBI): 91
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P36896
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.