ACVR1B Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of NIH/3T3 using 83026-5-RR (same clone as 83026-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed NIH/3T3 cells using ACVR1B antibody (83026-5-RR, Clone: 230260E12 ) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 83026-5-PBS in a different storage buffer formulation.

• 

  FC experiment of HEK-293 using 83026-5-RR (same clone as 83026-5-PBS)

  1x10^6 HEK-293 cells were intracellularly stained with 0.25 ug Anti-Human ACVR1B (83026-5-RR, Clone:230260E12) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83026-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83026-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83026-5-RR against Human ACVR1B were performed. The affinity constant is 16.1 nM.

ACVR1B Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra), Indirect ELISA

Cat No. 83026-5-PBS

Clone No.230260E12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra), Indirect ELISA

Synonyms

230260E12, activin A receptor, type IB, Activin receptor like kinase 4, Activin receptor type 1B, Activin receptor type-1B

---

Product Information

83026-5-PBS targets ACVR1B in IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0129

  Product name: Recombinant human ACVR1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 211-448 aa of BC000254

  Sequence: EIIGKGRFGEVWRGRWRGGDVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTIEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIADLGLAVRHDAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNSGGVHEEYQLPYYDLVPSDPSIEEMRKVVC

• Full Name: activin A receptor, type IB
• Calculated Molecular Weight: 57 kDa
• GenBank Accession Number: BC000254
• Gene Symbol: ACVR1B
• Gene ID (NCBI): 91
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P36896
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ACVR1B (ALK4, activin A receptor type 1B) is a transforming growth factor-beta (TGF-beta) superfamily member (PMID: 37020544). A potential role for ACVR1B in regulating muscle mass is that it is part of the transforming growth factor b (TGFb) pathway regulating myostatin (PMID: 21063444).