ADAD2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ADAD2 Polyclonal antibody, PBS Only (21217-1-PBS)

• 

  IHC staining of mouse testis using 21217-1-AP (same clone as 21217-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 21217-1-AP (ADAD2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21217-1-PBS in a different storage buffer formulation.

ADAD2 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 21217-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

21217-1-PBS targets ADAD2 in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15650

  Product name: Recombinant human ADAD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 244-583 aa of BC033491

  Sequence: REIPRARGHVKEIYKLVALGTGSSCCAGWLEFSGQQLHDCHGLVIARRALLRFLFRQLLLATQGGPKGKEQSVLAPQPGPGPPFTLKPRVFLHLYISNTPKGAARDIYLPPTSEGGLPHSPPMRLQAHVLGQLKPVCYVAPSLCDTHVGCLSASDKLARWAVLGLGGALLAHLVSPLYSTSLILADSCHDPPTLSRAIHTRPCLDSVLGPCLPPPYVRTALHLFAGPPVAPSEPTPDTCRGLSLNWSLGDPGIEVVDVATGRVKANAALGPPSRLCKASFLRAFHQAARAVGKPYLLALKTYEAAKAGPYQEARRQLSLLLDQQGLGAWPSKPLVGKFRN

• Full Name: adenosine deaminase domain containing 2
• Calculated Molecular Weight: 665 aa, 71 kDa
• Observed Molecular Weight: 62-71 kDa
• GenBank Accession Number: BC033491
• Gene Symbol: ADAD2
• Gene ID (NCBI): 161931
• RRID: AB_10732691
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NCV1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.