ADAM17 Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 84292-2-PBS

  Biolayer interferometry (BLl) kinetic assay of 84292-2-PBS against Human ADAM17 was performed. The affinity constant is 1.09 nM.

ADAM17 Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 84292-2-PBS

Clone No.241305F10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

ADAM 17, cSVP, Disintegrin and metalloproteinase domain-containing protein 17, EC:3.4.24.86, Snake venom-like protease

---

Product Information

84292-2-PBS targets ADAM17 in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag32418

  Product name: Recombinant human ADAM17 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 693-824 aa of BC136783

  Sequence: CVDKKLDKQYESLSLFHPSNVEMLSSMDSASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKDPFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC

• Full Name: ADAM metallopeptidase domain 17
• Calculated Molecular Weight: 824 aa, 93 kDa
• GenBank Accession Number: BC136783
• Gene Symbol: ADAM17
• Gene ID (NCBI): 6868
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P78536
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.