ADAM2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ADAM2 Polyclonal antibody, PBS Only (13952-1-PBS)

• 

  WB analysis of mouse testis using 13952-1-AP (same clone as 13952-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 13952-1-AP (ADAM2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13952-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 13952-1-AP (same clone as 13952-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 13952-1-AP (ADAM2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13952-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 13952-1-AP (same clone as 13952-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 13952-1-AP (ADAM2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13952-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human testis using 13952-1-AP (same clone as 13952-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 13952-1-AP (ADAM2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13952-1-PBS in a different storage buffer formulation.

ADAM2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13952-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

13952-1-PBS targets ADAM2 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5063

  Product name: Recombinant human ADAM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-353 aa of BC034957

  Sequence: MWRVLFLLSGLGGLRMDSNFDSLPVQITVPEKIRSIIKEGIESQASYKIVIEGKPYTVNLMQKNFLPHNFRVYSYSGTGIMKPLDQDFQNFCHYQGYIEGYPKSVVMVSTCTGLRGVLQFENVSYGIEPLESSVGFEHVIYQVKHKKADVSLYNEKDIESRDLSFKLQSVEYNHMGSDTTVVAQKVFQLIGLTNAIFVSFNITIILSSLELWIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHPRTISLESLAVILAQLLSLSMGITYDDINKCQCSGAVCIMNPEAIHFSGVKIFSNCSFEDFAHFISKQKSQCLH

• Full Name: ADAM metallopeptidase domain 2
• Calculated Molecular Weight: 82 kDa
• Observed Molecular Weight: 50-55 kDa, 65-75 kDa
• GenBank Accession Number: BC034957
• Gene Symbol: ADAM2
• Gene ID (NCBI): 2515
• RRID: AB_2877996
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99965
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The members of the ADAM (a disintegrin and metalloprotease) family are membrane-anchored multi-domain proteins that play prominent roles in male reproduction(PMID: 27341348). Fertilin, a heterodimeric protein complex composed of a(ADAM1) and b(ADAM2) subunits present on the sperm surface, has been believed to mediate adhesion and fusion between the sperm and egg plasma membranes. ADAM2-deficient mouse sperm is also defective in adhesion to and fusion with the egg membrane (PMID:16407235). It has 2 isoforms produced by alternative splicing and 5 glycosylation sites.