ADAM22 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ADAM22 Polyclonal antibody, PBS Only (27496-1-PBS)

• 

  WB analysis using 27496-1-AP (same clone as 27496-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27496-1-AP (ADAM22 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27496-1-PBS in a different storage buffer formulation.

ADAM22 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27496-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

ADAM 22, Disintegrin and metalloproteinase domain-containing protein 22, MDC2, Metalloproteinase-disintegrin ADAM22-3, Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 2

---

Product Information

27496-1-PBS targets ADAM22 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26783

  Product name: Recombinant human ADAM22 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 770-870 aa of BC125118

  Sequence: GLSHSWSERIPDTKHISDICENGRPRSNSWQGNLGGNKKKIRGKRFRPRSNSTETLSPAKSPSSSTGSIASSRKYPYPMPPLPDEDKKVNRQSARLWETSI

• Full Name: ADAM metallopeptidase domain 22
• Observed Molecular Weight: 75-90 kDa
• GenBank Accession Number: BC125118
• Gene Symbol: ADAM22
• Gene ID (NCBI): 53616
• RRID: AB_3742234
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P0K1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.