ADAM32 Polyclonal antibody

• 

  WB analysis using 27530-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27530-1-AP (ADAM32 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

ADAM32 Polyclonal Antibody for WB, ELISA

Cat No. 27530-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

ADAM 32, Disintegrin and metalloproteinase domain-containing protein 32, UNQ5982/PRO21340

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27530-1-AP targets ADAM32 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26450

  Product name: Recombinant human ADAM32 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 704-787 aa of BC026169

  Sequence: RKQLKKWFAKEEEFPSSESKSEGSTQTYASQSSSEGSTQTYASQTRSESSSQADTSKSKSEDSAEAYTSRSKSQDSTQTQSSSN

• Full Name: ADAM metallopeptidase domain 32
• Calculated Molecular Weight: 787 aa, 88 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC026169
• Gene Symbol: ADAM32
• Gene ID (NCBI): 203102
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TC27
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ADAM32 may play a role in sperm development and fertilization and it is a non-catalytic metalloprotease-like protein. In mature sperm from cauda epididymis and vas deferens, a band of 44 kDa for ADAM32 is detected and indicates that ADAM32 is made as precursors and processed to lower molecular-weight forms during sperm maturation in the epididymis(PMID:16407499). The full length protein has a signal peptide, a propeptide and 4 glycosylation sites.