ADAMDEC1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of MCF-7 using 82985-1-RR (same clone as 82985-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 82985-1-RR (ADAMDEC1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82985-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82985-1-RR

  Biolayer interferometry (BLl) kinetic assays of 82985-1-RR against Human ADAMDEC1 were performed. The affinity constant is 19.4 pM.

ADAMDEC1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 82985-1-PBS

Clone No.230367F9

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, Indirect ELISA

Synonyms

EC:3.4.24.-, ADAM-like protein decysin-1, ADAMDEC 1, ADAM DEC1, A disintegrin and metalloproteinase domain-like protein decysin-1

---

Product Information

82985-1-PBS targets ADAMDEC1 in WB, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag12265

  Product name: Recombinant human ADAMDEC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 56-470 aa of BC074877

  Sequence: REIKNNQTEKHGKEERYEPEVQYQMILNGEEIILSLQKTKHLLGPDYTETLYSPRGEEITTKPENMEHCYYKGNILNEKNSVASISTCDGLRGYFTHHHQRYQIKPLKSTDEKEHAVFTSNQEEQDPANHTCGVKSTDGKQGPIRISRSLKSPEKEDFLRAQKYIDLYLVLDNAFYKNYNENLTLIRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVVPSASTTFDNFLRWHSSNLGKKIHDHAQLLSGISFNNRRVGLAASNSLCSPSSVAVIEAKKKNNVALVGVMSHELGHVLGMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE

• Full Name: ADAM-like, decysin 1
• Calculated Molecular Weight: 470 aa, 53 kDa
• Observed Molecular Weight: 48-53 kDa
• GenBank Accession Number: BC074877
• Gene Symbol: ADAMDEC1
• Gene ID (NCBI): 27299
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O15204
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Metalloendopeptidase ADAM-Like Decysin 1 (ADAMDEC1) was first identified as a unique member of the matrix metalloprotease (ADAM) family. ADAMs are increasingly recognized as playing an important role in gut homeostasis and bowel inflammation. ADAMDEC1 is abundantly, and almost exclusively, expressed in the gastrointestinal (GI) tract.