ADAMTS1 Polyclonal antibody

• 

  IHC staining of human liver cancer using 12749-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12749-1-AP (ADAMTS1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 12749-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12749-1-AP (ADAMTS1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 12749-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HepG2 cells using 12749-1-AP (ADAMTS1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HEK-293 using 12749-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HEK-293 cells using 12749-1-AP (ADAMTS1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

ADAMTS1 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 12749-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

ADAM-TS1, ADAM-TS 1, ADAMTS 1, ADAM TS1, ADAM TS 1

---

Tested Applications

• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells, HEK-293 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 5 publications below
• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

12749-1-AP targets ADAMTS1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3485

  Product name: Recombinant human ADAMTS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 253-546 aa of BC036515

  Sequence: FVSSHRYVETMLVADQSMAEFHGSGLKHYLLTLFSVAARLYKHPSIRNSVSLVVVKILVIHDEQKGPEVTSNAALTLRNFCNWQKQHNPPSDRDAEHYDTAILFTRQDLCGSQTCDTLGMADVGTVCDPSRSCSVIEDDGLQAAFTTAHELGHVFNMPHDDAKQCASLNGVNQDSHMMASMLSNLDHSQPWSPCSAYMITSFLDNGHGECLMDKPQNPIQLPGDLPGTSYDANRQCQFTFGEDSKHCPDAASTCSTLWCTGTSGGVLVCQTKHFPWADGTSCGEGKWCINGKCV

• Full Name: ADAM metallopeptidase with thrombospondin type 1 motif, 1
• Calculated Molecular Weight: 967 aa, 105 kDa
• GenBank Accession Number: BC036515
• Gene Symbol: ADAMTS1
• Gene ID (NCBI): 9510
• RRID: AB_2877879
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHI8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB,IHC	Front Aging Neurosci; Induction of A Disintegrin and Metalloproteinase with Thrombospondin motifs 1 by a rare variant or cognitive activities reduces hippocampal amyloid-β and consequent Alzheimer's disease risk; Authors - Yunjie Qiu
human	IHC	NPJ Precis Oncol; Identification of novel prognostic and predictive biomarkers in salivary duct carcinoma via comprehensive molecular profiling; Authors - Shinji Kohsaka
mouse	WB	Front Genet; Identification of polyunsaturated fatty acids related key modules and genes in metabolic dysfunction-associated fatty liver disease using WGCNA analysis; Authors - Cheng Xiao
rat	WB	JOR Spine; Dynamics of N6-methyladenosine modification during aging and their potential roles in the degeneration of intervertebral disc; Authors - Libangxi Liu
mouse	WB	Life Sci; The matrix protease ADAMTS1 is transcriptionally activated by KLF6 and contributes to cardiac fibrosis in non-ischemic cardiomyopathy; Authors - Nan Li
mouse	IF	J Mol Cell Cardiol; Deficiency of Sox7 leads to congenital aortic stenosis via abnormal valve remodeling; Authors - Weiqi Feng