ADAMTS1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ADAMTS1 Polyclonal antibody (12749-1-AP)

ADAMTS1 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 12749-1-AP Copied!

Publications (8)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

ADAM-TS1, ADAM-TS 1, ADAMTS 1, ADAM TS1, ADAM TS 1

• 

  IHC staining of human liver cancer using 12749-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12749-1-AP (ADAMTS1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 12749-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12749-1-AP (ADAMTS1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 12749-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HepG2 cells using 12749-1-AP (ADAMTS1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HEK-293 using 12749-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HEK-293 cells using 12749-1-AP (ADAMTS1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ADAMTS1 in ?

Chat with Able

---

Tested Applications

• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells, HEK-293 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12749-1-AP targets ADAMTS1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3485

  Product name: Recombinant human ADAMTS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 253-546 aa of BC036515

  Sequence: FVSSHRYVETMLVADQSMAEFHGSGLKHYLLTLFSVAARLYKHPSIRNSVSLVVVKILVIHDEQKGPEVTSNAALTLRNFCNWQKQHNPPSDRDAEHYDTAILFTRQDLCGSQTCDTLGMADVGTVCDPSRSCSVIEDDGLQAAFTTAHELGHVFNMPHDDAKQCASLNGVNQDSHMMASMLSNLDHSQPWSPCSAYMITSFLDNGHGECLMDKPQNPIQLPGDLPGTSYDANRQCQFTFGEDSKHCPDAASTCSTLWCTGTSGGVLVCQTKHFPWADGTSCGEGKWCINGKCV

• Full Name: ADAM metallopeptidase with thrombospondin type 1 motif, 1
• Calculated Molecular Weight: 967 aa, 105 kDa
• GenBank Accession Number: BC036515
• Gene Symbol: ADAMTS1
• Gene ID (NCBI): 9510
• RRID: AB_2877879
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHI8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Anti-ADAMTS1 (Cat# 12749-1-AP) has 8 citations across journals including NPJ Precision Oncology, Atherosclerosis, Life Sciences, Cell Biology and Toxicology, Frontiers in Aging Neuroscience, Journal of Molecular and Cellular Cardiology, JOR Spine, and Frontiers in Genetics. Research fields span salivary duct carcinoma, vascular calcification, cardiac fibrosis, Alzheimer's disease, congenital aortic stenosis, intervertebral disc degeneration, and metabolic dysfunction-associated fatty liver disease.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	NPJ Precis Oncol; Identification of novel prognostic and predictive biomarkers in salivary duct carcinoma via comprehensive molecular profiling; Authors - Shinji Kohsaka
human,rat	WB	Atherosclerosis; Loss of ADAMTS5 promotes vascular calcification via versican/integrin β1/FAK signal; Authors - Zhenyu Zhu ; KD Validated
mouse	WB	Life Sci; The matrix protease ADAMTS1 is transcriptionally activated by KLF6 and contributes to cardiac fibrosis in non-ischemic cardiomyopathy; Authors - Nan Li
human,mouse	IHC,IF	Cell Biol Toxicol; Targeting ADAMTS1/HDAC6 alleviates TGF-β1/SMAD2-associated cardiac fibrosis in cardiac fibrosis post-myocardial infarction.; Authors - Qiao Jin
human,mouse	WB,IHC	Front Aging Neurosci; Induction of A Disintegrin and Metalloproteinase with Thrombospondin motifs 1 by a rare variant or cognitive activities reduces hippocampal amyloid-β and consequent Alzheimer's disease risk; Authors - Yunjie Qiu
mouse	IF	J Mol Cell Cardiol; Deficiency of Sox7 leads to congenital aortic stenosis via abnormal valve remodeling; Authors - Weiqi Feng