ADAMTS19 Polyclonal antibody

• 

  IHC staining of mouse kidney using 32890-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 32890-1-AP (ADAMTS19 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 32890-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 32890-1-AP (ADAMTS19 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ADAMTS19 Polyclonal Antibody for IHC, ELISA

Cat No. 32890-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

Synonyms

A disintegrin and metalloproteinase with thrombospondin motifs 19, ADAM-TS 19, ADAM-TS19, ADAMTS-19, EC:3.4.24.-

---

Tested Applications

• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32890-1-AP targets ADAMTS19 in IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36946

  Product name: Recombinant human ADAMTS19 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 580-750 aa of NM_133638

  Sequence: CQEMQHVICTGLWCKVEGEKECRTKLDPPMDGTDCDLGKWCKAGECTSRTSAPEHLAGEWSLWSPCSRTCSAGISSRERKCPGLDSEARDCNGPRKQYRICENPPCPAGLPGFRDWQCQAYSVRTSSPKHILQWQAVLDEEKPCALFCSPVGKEQPILLSEKVMDGTSCGY

• Full Name: ADAM metallopeptidase with thrombospondin type 1 motif, 19
• Calculated Molecular Weight: 134kDa
• GenBank Accession Number: NM_133638
• Gene Symbol: ADAMTS19
• Gene ID (NCBI): 171019
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8TE59
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ADAMTS19 encodes a member of the ADAMTS (a disintegrin and metalloproteinase domain with thrombospondin motifs) protein family with emerging roles in carcinogenesis and metastasis. ADAMTS shares several distinct protein modules including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. The promoter of ADAMTS19 is targeted by hypermethylation in a significant proportion of gastrointestinal cancers, particularly in BRAF-mutant cancers, and that this hypermethylation associates with transcriptional downregulation and reduces the in vitro migration capabilities of Colorectal cancer cells (PMID: 26634009).