ADAMTSL1 Polyclonal antibody

• 

  WB analysis using 13337-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13337-1-AP (ADAMTSL1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

ADAMTSL1 Polyclonal Antibody for WB, ELISA

Cat No. 13337-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

ADAMTS like 1, ADAMTS like protein 1, ADAMTSL 1, ADAMTSL-1, ADAMTS-like protein 1

---

Tested Applications

• Positive WB detected in: rat cerebellum tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13337-1-AP targets ADAMTSL1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4154

  Product name: Recombinant human ADAMTSL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-355 aa of BC030262

  Sequence: MECCRRATPGTLLLFLAFLLLSSRTARSEEDRDGLWDAWGPWSECSRTCGGGASYSLRRCLSSKSCEGRNIRYRTCSNVDCPPEAGDFRAQQCSAHNDVKHHGQFYEWLPVSNDPDNPCSLKCQAKGTTLVVELAPKVLDGTRCYTESLDMCISGLCQIVGCDHQLGSTVKEDNCGVCNGDGSTCRLVRGQYKSQLSATKSDDTVVAIPYGSRHIRLVLKGPDHLYLETKTLQGTKGENSLSSTGTFLVDNSSVDFQKFPDKEILRMAGPLTADFIVKIRNSGSADSTVQFIFYQPIIHRWRETDFFPCSATCGGGYQLTSAECYDLRSNRVVADQYCHYYPENIKPKPKLQECN

• Full Name: ADAMTS-like 1
• Calculated Molecular Weight: 525 aa, 58 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC030262
• Gene Symbol: ADAMTSL1
• Gene ID (NCBI): 92949
• RRID: AB_3669160
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N6G6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ADAMTS-like genes (ADAMTSLs) produce proteins similar to those encoded by ADAMTS genes, only without catalytic domains, and may be responsible for regulating activities of ADAMTS. ADAMTSL1 was first identified in 1997 and was called punctin. ADAMTSL1 is distinct from other genes in the ADAMTS family, and binds to the extracellular matrix in a spatially-specific manner. (PMID: 32095376)