ADAMTSL3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ADAMTSL3 Polyclonal antibody (26653-1-AP)

• 

  IHC staining of mouse kidney using 26653-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 26653-1-AP (ADAMTSL3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 26653-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 26653-1-AP (ADAMTSL3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ADAMTSL3 Polyclonal Antibody for IHC, ELISA

Cat No. 26653-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

Synonyms

ADAMTS like 3, ADAMTS like protein 3, ADAMTSL 3, KIAA1233, Punctin 2

---

Tested Applications

• Positive IHC detected in: human placenta tissue, mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26653-1-AP targets ADAMTSL3 in IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24488

  Product name: Recombinant human ADAMTSL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 616-720 aa of BC128389

  Sequence: TERPCLLEACDESPASRELDIPLPEDSETTYDWEYAGFTPCTATCLGGHQEAIAVCLHIQTQQTVNDSLCDMVHRPPAMSQACNTEPCPPRWHVGSWGPCSATCG

• Full Name: ADAMTS-like 3
• Calculated Molecular Weight: 1691 aa, 189 kDa
• GenBank Accession Number: BC128389
• Gene Symbol: ADAMTSL3
• Gene ID (NCBI): 57188
• RRID: AB_3742198
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P82987
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ADAMTSL3 (ADAMTS-Like Protein 3) is a member of the ADAMTSL family of matricellular proteins, which are involved in extracellular matrix (ECM) remodeling and regulation of various biological processes, including cardiac function, cartilage development, and inflammation. (PMID: 38324186)