ADAMTSL5 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ADAMTSL5 Polyclonal antibody (32965-1-AP)

• 

  WB analysis using 32965-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32965-1-AP (ADAMTSL5 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

ADAMTSL5 Polyclonal Antibody for WB, ELISA

Cat No. 32965-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

ADAMTSL-5, ADAMTS-like protein 5, Thrombospondin type-1 domain-containing protein 6, THSD6

---

Tested Applications

• Positive WB detected in: COLO 320 cells, Caco-2 cells, HeLa cells, mouse skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32965-1-AP targets ADAMTSL5 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37537

  Product name: Recombinant human ADAMTSL5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 370-481 aa of NM_213604

  Sequence: AHRLLHYCGSDFVFQARVLGHHHQAQETRYEVRIQLVYKNRSPLRAREYVWAPGHCPCPMLAPHRDYLMAVQRLVSPDGTQDQLLLPHAGYARPWSPAEDSRIRLTARRCPG

• Full Name: ADAMTS-like 5
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: NM_213604
• Gene Symbol: ADAMTSL5
• Gene ID (NCBI): 339366
• RRID: AB_3742806
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6ZMM2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ADAMTSL5 encodes ADAMTS-like protein 5, a secreted extracellular matrix protein that binds heparin and microfibrils and is involved in extracellular matrix organization. It is located in the extracellular region, extracellular space, extracellular matrix, elastic fiber, and Golgi apparatus, placing it in the secretory route and at matrix-associated sites where it can engage extracellular structural components.