ADAMTSL5 Polyclonal antibody

• 

  WB analysis using 32965-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32965-1-AP (ADAMTSL5 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

ADAMTSL5 Polyclonal Antibody for WB, ELISA

Cat No. 32965-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

ADAMTSL-5, ADAMTS-like protein 5, Thrombospondin type-1 domain-containing protein 6, THSD6

---

Tested Applications

• Positive WB detected in: COLO 320 cells, Caco-2 cells, HeLa cells, mouse skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32965-1-AP targets ADAMTSL5 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37537

  Product name: Recombinant human ADAMTSL5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 370-481 aa of NM_213604

  Sequence: AHRLLHYCGSDFVFQARVLGHHHQAQETRYEVRIQLVYKNRSPLRAREYVWAPGHCPCPMLAPHRDYLMAVQRLVSPDGTQDQLLLPHAGYARPWSPAEDSRIRLTARRCPG

• Full Name: ADAMTS-like 5
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: NM_213604
• Gene Symbol: ADAMTSL5
• Gene ID (NCBI): 339366
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6ZMM2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.